KEGG   Photorhabdus asymbiotica: PAU_00742Help
Entry
PAU_00742         CDS       T00941                                 

Gene name
gene0005
Definition
(GenBank) putative aerobic formate dehydrogenase-o subunit
  KO
K00127  formate dehydrogenase subunit gamma
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00630  Glyoxylate and dicarboxylate metabolism
pay00680  Methane metabolism
pay01100  Metabolic pathways
pay01120  Microbial metabolism in diverse environments
pay01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAU_00742 (gene0005)
  Energy metabolism
   00680 Methane metabolism
    PAU_00742 (gene0005)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB PepSY_TM DUF4405 Glyco_transf_90
Motif
Other DBs
NCBI-ProteinID: CAQ82834
UniProt: C7BM15
Position
complement(840600..841238)
Genome map
AA seq 212 aa AA seqDB search
MKKKDTILRHSPIERVNHWAVVLCFLFTGISGLGFFFPSFNWLMNILGTPQLARILHPFI
GSVMFFLFTFMFVRYFKHNFIDKEDIVWLKNIRKIIRNEEAGDIGQYNLGQKGIYWSISI
CLILLAMSGVIIWRPYFADFFSIPLIRLALLVHSLAGVGLILLILIHAYAAFWVKGSIRA
MVEGWVTRGWAKKHHPRWYREIRQKEQQEKKP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagatactattctccgccactcaccgattgagcgagtaaatcactgggcg
gtcgtactctgttttctatttaccgggatcagtgggttaggattcttcttcccatccttt
aactggttgatgaatatcttaggtacgccccagttagcccggatactgcatccgtttatc
ggttcagtgatgtttttcttatttacctttatgtttgtcagatatttcaaacataacttt
atcgacaaagaggacattgtttggctgaaaaacattcgtaaaatcatcaggaatgaagaa
gctggcgatatcggtcagtacaatcttggtcagaaagggatctactggtctattagcatc
tgtctaatcttactggcaatgagtggcgtgattatctggcgtccctatttcgctgatttt
ttctccatcccgttgatccggcttgcgcttttggtccactctctggctggcgttggcctg
atcctgctgattctgatacatgcctatgccgcgttttgggtgaaaggatctatcagagca
atggttgaaggctgggtaactcgcggttgggcgaagaaacatcatcctcgctggtataga
gaaattcgtcagaaagagcagcaggagaaaaaaccttaa

DBGET integrated database retrieval system