KEGG   Photorhabdus asymbiotica: PAU_01613Help
Entry
PAU_01613         CDS       T00941                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00860  Porphyrin and chlorophyll metabolism
pay01100  Metabolic pathways
Module
pay_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAU_01613 (cobQ)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PAU_01613 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_S51 SNO
Motif
Other DBs
NCBI-ProteinID: CAQ83705
UniProt: C7BRY5
Position
1840784..1842322
Genome map
AA seq 512 aa AA seqDB search
MGLSLMLQGTASDVGKSVLVAGLCRIFVQDGYRCAPFKSQNMALNSGITINGEEMGRAQI
FQAEAAGIEPDVRMNPVLLKPTSDRKAQVVLMGKVACSMNAVEYHQYKPRLQQQISEVFY
SLAREYDVIVLEGAGSPAEINLRDRDIVNMGMAEMVDAPVLLVADIDRGGVFAAIYGTLA
LLRPEEKARVKGVIINKFRGDISLLQPGIEQIETLTGVPVLGVMPWLDIDLEDEDGVALQ
TGKYDGAAEKALDIAVIRLPHIANFTDFNALAVQPDVRLRYVTHPAALQPSDLIILPGSK
NTLGDLQWLRRNGLADALLTAHQAGIPVIGICGGYQMLGQRIIDGVESGIEQMEGLGLLD
METRFAHEKVTTRVNGSCLSGLPGLLSDCIEQPIRGYEIHMGSSSLGENATPFACITERN
SQAGSWFDGAVNREGNVMGSYIHGLFDSANFTRALLNALRQRKGLTAYQGDTLDYAHYKQ
TQFDRLAEAMREHLDIERIYQCMKTHQQDLAP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggattatctttaatgttgcagggtacggcatccgatgtagggaaaagcgtattagtt
gcgggattatgccgtatctttgttcaggatggttatcgctgcgcaccgtttaaatcacag
aatatggcgctgaattctggtatcactattaacggtgaagagatgggtagggcacaaatt
tttcaggcggaggcggcgggtatcgagcctgatgtacggatgaacccggtattgcttaaa
cccaccagcgaccgcaaggctcaagttgtgctaatgggaaaagtcgcctgtagcatgaat
gcggtggaatatcaccaatacaagcctcgtttgcagcagcaaatcagtgaagttttttat
agtttggcccgtgaatatgacgtgattgtgctggaaggggctggtagtccggcggagatc
aatttgcgtgatcgagacattgtcaacatgggaatggcggaaatggttgatgcgccggtg
ctgttggtcgcggatatcgatcgagggggcgtcttcgctgccatctacggcacgctggcg
ttgttgcgcccggaagaaaaagcgcgggtaaaaggggtcatcatcaacaaattccgaggt
gatatcagcctgctccagccgggtattgaacagattgaaaccttaactggagtgcctgtt
ctgggggtgatgccttggctggatattgatctggaagatgaggacggcgtagcgttgcaa
accggtaaatatgatggtgcagcagaaaaagcgttggatatcgcggtgattcgtttacct
catattgctaattttactgactttaatgcgctggcagtgcaacctgatgttcgtttgcgt
tatgtgactcatccagctgcgttacagccatcggatctgattatcttgcccggtagcaaa
aacacgttgggagatttgcaatggttgcggcgaaacggattagcggatgctctgttgacg
gcacatcaggctggtattcctgtgatcggtatctgcggtggttatcaaatgttgggacaa
cggattatcgatggagtggaatcgggtattgaacagatggagggtcttggattactggat
atggaaacccgatttgcccatgaaaaagtgacaaccagagtaaatggtagttgtttatct
ggattgccgggtttgttgtcagattgcattgagcagcctatccggggttatgagattcat
atgggcagttcgtcactgggggaaaatgcgacaccgtttgcctgtattactgagcgtaac
agccaagccggtagttggtttgatggtgcggttaatcgagaggggaatgtgatgggcagt
tatattcatggtttgtttgacagcgctaattttacccgtgctctgcttaatgctttacgt
cagcgcaaagggttaacggcttaccaaggtgacaccttggattacgctcactataaacaa
actcagtttgatcgcttggcggaagccatgcgcgagcacttggatatagaacggatttat
cagtgtatgaaaacccatcaacaagatttggcaccgtga

DBGET integrated database retrieval system