KEGG   Photorhabdus asymbiotica: PAU_01724Help
Entry
PAU_01724         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ83816
UniProt: C7BTG1
Position
complement(1949993..1950322)
Genome map
AA seq 109 aa AA seqDB search
MAQIQINPNQATDIYNNGNILLPSYQPHIGIKNVGLATVKVSSHWAPPFGDYTQYSVIEV
PPDEVGILLPPPNLICFFKVTATNLSGFLTAKIEMEVGTHNNPPWSKTA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatacagataaatcctaatcaagccactgatatctataataatggcaatata
ttactccctagttatcaacctcatatagggataaaaaacgtcggtctagccaccgttaaa
gtgagtagtcactgggcccctccattcggagattatactcaatatagcgttattgaagtc
ccccctgacgaggttggaatactcttaccaccacctaaccttatttgcttctttaaagtt
acagccaccaatctcagtggttttttaaccgcaaaaattgaaatggaggtagggacacac
aataatccgccttggagtaagaccgcataa

DBGET integrated database retrieval system