KEGG   Photorhabdus asymbiotica: PAU_01726Help
Entry
PAU_01726         CDS       T00941                                 

Gene name
lolC
Definition
(GenBank) lipoprotein releasing system transmembrane protein lolc
  KO
K09808  lipoprotein-releasing system permease protein
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02010  ABC transporters
Module
pay_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAU_01726 (lolC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01726 (lolC)
Transporters [BR:pay02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    PAU_01726 (lolC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX
Motif
Other DBs
NCBI-ProteinID: CAQ83818
UniProt: C7BTG3
Position
1950985..1952187
Genome map
AA seq 400 aa AA seqDB search
MLQSVSLFIGLRYMRGRAADKFGRFVSWLSAIGITLGVAALITVLSVMNGFERSLETSIL
GFMPQAIVTSASGSLNPTEHLASELANLKQINRITPLTMGDVVLQSARNVGVGVMLGITS
DEYEPLTEYLVNTDRHQLEPGSYNAILGEKLAEELGVKRGDRVRLMVPGASQLTPMGRIP
SQRLFMIVGTFASNSEVDGTQILVNQQDAARLMRYPLGNITGWRLYLKEPLAVDSLSLQI
MPEGLLWKDWRERKGEFFQAVRMEKNMMGLLLSLIIAVAAFNIITSLGLLVMEKQGEVAI
LQTQGLIRRQVMIIFMIQGAGAGIIGTLLGTGLGVLLSSQLNNLMPLLGLLTPGVELPVA
IEPLQVATIAISAMIIALLSTLYPSWRAAATQPAEALRYE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaatctgtctcattatttataggtttgcggtatatgcgtggccgggcagctgac
aaatttggtcggtttgtttcttggctgtcagcaatcggtattactcttggtgtcgctgca
ttaatcactgtattgtcagtgatgaatggttttgaacgttcattggaaaccagcattctt
ggttttatgccgcaggctattgtgacgtcggcaagcggttctctgaatcccacagagcat
ctggctagtgaactcgcgaacctgaagcaaatcaacaggattacaccattaacgatgggc
gacgttgtgttgcaaagcgctcgcaatgtcggtgtgggtgtgatgttgggtattacttca
gatgagtatgagccactgactgaatatttggttaacaccgatcgccatcaacttgaacct
ggtagttataacgcgattttaggagaaaaactggcggaggagcttggagtaaaacgtggt
gaccgagttcgtctgatggtgccaggtgcaagccaattgacgccaatggggagaattcct
agccaacgcttgtttatgattgtgggtacttttgcttctaacagtgaagtagacggcaca
caaattcttgttaatcaacaagatgcagcgcgtttgatgcgttatccattgggtaatatt
actggctggcgtctctatcttaaagaaccgttggcagtggatagcttgagcttgcaaatc
atgccggaagggttgttatggaaagactggcgcgaacgcaagggtgaatttttccaggct
gtaaggatggaaaaaaatatgatgggattgttgttgagcctgattattgctgtggctgca
ttcaatatcattacttcccttggattactggtaatggaaaagcagggtgaagtagcgatt
ttgcaaacacagggcctgatacgccgtcaggtcatgataatttttatgatccaaggtgcc
ggtgccgggattatcggtacattattgggaaccgggcttggtgttctactttcgagccag
cttaataatttaatgccacttcttggtctgttgactccaggtgttgagttgcctgttgct
attgagccattacaagtcgctacaattgcaatttcagcgatgattattgccttgttatct
acgttatatccttcctggcgtgccgctgccacccaacctgctgaggctttgcgttatgaa
tag

DBGET integrated database retrieval system