KEGG   Photorhabdus asymbiotica: PAU_01727Help
Entry
PAU_01727         CDS       T00941                                 

Gene name
lolD
Definition
(GenBank) lipoprotein-releasing system ATP-binding protein
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02010  ABC transporters
Module
pay_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAU_01727 (lolD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01727 (lolD)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     PAU_01727 (lolD)
Transporters [BR:pay02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    PAU_01727 (lolD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_16 SbcCD_C AAA_22 FtsK_SpoIIIE DUF87 AAA_23 AAA_30 RepB-RCR_reg AAA_28 MMR_HSR1 AAA_33 AAA_15
Motif
Other DBs
NCBI-ProteinID: CAQ83819
UniProt: C7BTG4
Position
1952180..1952884
Genome map
AA seq 234 aa AA seqDB search
MNSRPLLLCNNLCKKYQEGQVLTEVLKNVTFSINRGEMMAIVGSSGSGKSTLLHLLGGLD
TPTSGEVLFKGQSLNKMSSRARAELRNHELGFIYQFHHLLPDFNAIENVAMPLLIGGKNR
DQAQRKALEMLAAVGLEKRVYHRQSELSGGERQRVAIARALVNEPSLVLADEPTGNLDLR
NADSIFELLGELNRQQGTGFLVVTHDLKLADRLDRQVEMRDGYLQDELTLTGAM
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtcgaccattactgttgtgtaataatctgtgtaaaaaatatcaggaagggcag
gtactgaccgaagtactgaaaaatgtcaccttttctattaatcggggcgaaatgatggcg
attgtaggaagctcggggtcaggtaagagtacgcttctgcatttgcttggtgggttggat
acaccgacttctggtgaagtcctatttaagggacagtctctgaataaaatgtcttccaga
gccagagcagaattgcgtaatcatgaattaggctttatttatcagtttcaccatctattg
ccagattttaatgcgatagaaaatgtggctatgccactactgattggtggcaaaaatcgg
gatcaagcacagaggaaggcgttagaaatgctggctgctgttggtctggagaaacgagtt
tatcaccgccagtcggaattatcgggtggtgaacgtcagcgtgtggcgattgccagagca
ttagtgaatgagccctctttagttctggctgatgaaccaactggcaaccttgatttacgt
aatgcagatagcatttttgaattattgggcgagcttaaccggcagcaaggtactgggttt
ctggtagtcacccatgatttgaaacttgccgacagattggatcgccaggtagagatgcgt
gatggttatttgcaagatgaattgaccctgacgggggcaatgtaa

DBGET integrated database retrieval system