KEGG   Photorhabdus asymbiotica: PAU_01733Help
Entry
PAU_01733         CDS       T00941                                 

Gene name
phoQ
Definition
(GenBank) sensor protein
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay01503  Cationic antimicrobial peptide (CAMP) resistance
pay02020  Two-component system
Module
pay_M00444  PhoQ-PhoP (magnesium transport) two-component regulatory system
pay_M00709  Macrolide resistance, MacAB-TolC transporter
pay_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
pay_M00724  Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:pay00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PAU_01733 (phoQ)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PAU_01733 (phoQ)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PAU_01733 (phoQ)
Protein kinases [BR:pay01001]
 Histidine kinases
  OmpR family
   PAU_01733 (phoQ)
Two-component system [BR:pay02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   PAU_01733 (phoQ)
Antimicrobial resistance genes [BR:pay01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    PAU_01733 (phoQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HisKA HAMP HATPase_c_2 FlxA
Motif
Other DBs
NCBI-ProteinID: CAQ83825
UniProt: C7BTH0
Position
complement(1958503..1959966)
Genome map
AA seq 487 aa AA seqDB search
MLKRQKKPFSLRTRFLMATAAVILALTMSYGIVAIVGYLVSFDKTAYTLLRSQSNLFFSL
AQWNNNKLDISVPPNFTLNNPSLVLIYNDKGTILWRQRHIPKVERSIPSEWLKEDGLYEL
DTDLKSSRDLLKDSGNMQGQLNKLGALDENEDNELTHSVSVNRYNATEHLPELTIVVIDT
IPQDLQKTVLVWEWFGYVLIANLILVIPLIWLAAHWSLRPIKSLIHQVSSLEKGEREKLD
ENPPAELRGLVRNLNVLLNNERNRYTKYRTTLADLTHSLKTPLAVLQSTLRSLRSSKQMT
IEQAEPIMLEQIGRISQQIGYYLHRASMRGDHSIIMREISSVPALLDSLCSALTKVYQRK
GVSLALDVSPEITWLGEKNDFMEIMGNVLENACKYCLEFVEISATMDHDSLKIIVDDDGP
GVPVDKREMIFQRGQRVDTLQLGQGLGLSIASEIIEQYKGDISINDSPLGGARICVTFRC
QQINDDD
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaaacgccaaaagaaacctttttcactccgtacccggtttttaatggcgactgcc
gcagtcattctggctctgacaatgtcttatggtattgttgccattgtcggttacctggtc
agttttgacaaaaccgcttatacactactacgcagtcagagcaacttgtttttcagcctt
gctcagtggaacaacaataagctggatatttcggtaccccccaatttcacactaaacaac
ccatcattagttctgatttataatgacaaaggcactatcctctggcgtcaacgtcatatt
cccaaagtagaaagatctattccaagtgagtggttgaaggaagatggtttatatgaactg
gatactgacctgaaaagcagccgagacttgttaaaagactcaggcaatatgcagggacaa
ttaaacaaacttggcgctctcgacgaaaacgaagataacgaactgacccattccgtttct
gttaacaggtataacgcaacagagcatctgccagagttaactatcgtagtgattgatacc
attccgcaagatttgcagaaaacggttctggtatgggaatggttcggctatgtactcatt
gccaatcttattttggtcatcccattaatctggctagcagctcactggagtctacgacca
atcaaatcgcttatccatcaagttagctcgttagaaaaaggtgaaagggaaaaattagat
gaaaatccaccagctgagctgcggggattggttcgtaaccttaatgtgctactcaataat
gagcgcaaccgctataccaaataccgtacaacactggctgatctaacacacagtttaaaa
acaccgttggctgtattgcaatcaactctccgttctttgcgcagtagtaaacaaatgacc
attgaacaggcagaacctatcatgcttgaacagataggccgtatttctcagcagataggc
tattatttgcaccgggccagtatgcgcggtgatcatagtattattatgcgggaaatttct
tctgttccagctttactggatagtttgtgtagcgctttaacaaaagtctatcaacgcaaa
ggtgtcagtctcgcgttagatgtatcgccagaaattacctggcttggtgaaaaaaatgac
tttatggaaatcatgggtaatgttctggaaaatgcctgtaagtattgccttgaatttgtt
gagatttcagcaactatggatcatgattcgctgaagatcattgttgatgacgatggcccc
ggtgttcctgtggataaacgcgaaatgattttccaacggggtcaacgtgtcgatacctta
cagctaggtcaaggacttggattatccattgcctctgaaatcatcgaacaatataaaggt
gatatcagtatcaatgatagcccgcttggcggtgccagaatttgcgtcacattccgctgc
cagcaaattaacgatgacgattaa

DBGET integrated database retrieval system