KEGG   Photorhabdus asymbiotica: PAU_01734Help
Entry
PAU_01734         CDS       T00941                                 

Gene name
phoP
Definition
(GenBank) two-component response regulator phop
  KO
K07660  two-component system, OmpR family, response regulator PhoP
Organism
pay  Photorhabdus asymbiotica
Pathway
pay01503  Cationic antimicrobial peptide (CAMP) resistance
pay02020  Two-component system
Module
pay_M00444  PhoQ-PhoP (magnesium transport) two-component regulatory system
pay_M00709  Macrolide resistance, MacAB-TolC transporter
pay_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
pay_M00724  Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAU_01734 (phoP)
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PAU_01734 (phoP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pay02022]
    PAU_01734 (phoP)
   01504 Antimicrobial resistance genes [BR:pay01504]
    PAU_01734 (phoP)
Two-component system [BR:pay02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   PAU_01734 (phoP)
Antimicrobial resistance genes [BR:pay01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    PAU_01734 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: CAQ83826
UniProt: C7BTH1
Position
complement(1959986..1960654)
Genome map
AA seq 222 aa AA seqDB search
MRILIVEDNMLLRHHLTVQLRDTGHLVDAAANAKEADYYLAESEPDIAIVDLGLPGEDGL
SLIRRWRQKDEKLPILVLTARESWQEKVTVLDAGADDYVTKPFHLEEIIARMQALLRRNN
GLVSQIIEFPPFRIDLSRKELTIYGESVKLTAFEYKIVEILMCNSDKIVTKESLMRQLYS
DAELREGHSIDVLIGRLRKKIQDVWPYEAIVTVRSQGYRFDV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcggatattgattgttgaagacaacatgttactacgccaccatttgacggtacaactt
cgtgacacaggtcatctggttgacgctgccgcaaatgctaaagaagctgattactatctg
gcagagagcgaaccagatatcgctattgttgaccttggtttgcctggagaagacggttta
agtctgatccgtcgctggcgccagaaagatgagaaactccctattcttgttctaaccgcc
cgtgaaagttggcaggaaaaagtcaccgttcttgacgcaggtgcagatgactatgtcacc
aaaccatttcatcttgaggaaattattgcccgtatgcaggcactcctgcgccgtaacaat
ggattggtttctcaaattatcgaattcccacctttcagaattgatctgtcacgcaaggaa
ttaacaatttatggtgaaagtgtcaaattgacggcttttgaatataaaattgttgaaata
ctgatgtgcaatagtgacaaaattgtcactaaagagtcgttaatgcgtcaactatattcc
gatgctgaactccgcgaaggccattctattgatgttttaatcgggcggctaagaaagaaa
atacaagatgtttggccttatgaagctatcgtgactgttcgcagccaaggctatcgcttt
gatgtataa

DBGET integrated database retrieval system