KEGG   Photorhabdus asymbiotica: PAU_01742Help
Entry
PAU_01742         CDS       T00941                                 

Definition
(GenBank) hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ83834
UniProt: C7BTH9
Position
1968766..1968879
Genome map
AA seq 37 aa AA seqDB search
MLLRGGGEEVVQVYPFISFLNVMLFIEMIFPTLVLWR
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgcttttacggggtggcggtgaagaggtggtacaagtttacccgtttattagtttcttg
aatgtcatgctattcattgagatgatatttcctacattagtattatggcgttga

DBGET integrated database retrieval system