KEGG   Photorhabdus asymbiotica: PAU_01757Help
Entry
PAU_01757         CDS       T00941                                 

Gene name
thiD
Definition
(GenBank) phosphomethylpyrimidine kinase (hmp-phosphate kinase)
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00730  Thiamine metabolism
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PAU_01757 (thiD)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     PAU_01757 (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     PAU_01757 (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB
Motif
Other DBs
NCBI-ProteinID: CAQ83849
UniProt: C7BTJ4
Position
1980366..1981163
Genome map
AA seq 265 aa AA seqDB search
MRINTLTIAGTDPSGGAGIQADLKTFSALGAYGTTVMTALVAQNTRGVQSVYDIAPAFVA
AQLESVLSDIRIDSAKIGMLSNAANVAVVADAISHYSIPYIVLDTVMVAKSGDPLLAPEA
VSLVVEQLLPKVSLITPNLPEAAVLLKCSVAKTETEMQKQGRELLSLGCEAVLLKGGHLI
NGESPDWLFMGNGEWRFTAPRINTRHTHGTGCTLSAALAALRPCYSDWQTTIPVAKSYLQ
TALACADSLEVGKGIGPVHHFHQWW
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagaattaatacactgacaattgctggcactgatcctagcggtggtgctggtattcag
gctgatttgaaaactttttctgcacttggggcttatggcacaacagtgatgacagcgctt
gttgcacaaaatactcgtggtgtacagtctgtttacgatatagccccagctttcgttgct
gcccagctggagtctgtgttgtcagatatcagaattgatagtgccaaaattggcatgtta
tctaatgcggctaatgttgcagtggttgcagatgcaataagccattattcaattccttat
attgtattggatacagtaatggttgcgaaaagcggagatccgctgctggctccggaagct
gtttccttagttgttgagcaattattacctaaggtttcgttgattacgccaaacttgcca
gaggccgcagttctgctgaaatgttcagtcgcaaaaactgaaacggagatgcaaaagcaa
gggcgtgaattgttatcattgggatgtgaagcggttctacttaaaggcggtcatcttata
aacggtgaaagccctgactggctatttatgggtaatggggaatggcgtttcactgctcct
agaatcaatacacgtcatactcatggcacagggtgtactctttctgctgcattagctgct
ttgcgtccatgttattcagattggcagacgacaattcctgttgccaaatcttatctccag
actgcgttagcatgtgcggattctcttgaagtaggtaaagggattggaccggtacatcat
tttcatcagtggtggtga

DBGET integrated database retrieval system