KEGG   Photorhabdus asymbiotica: PAU_01766Help
Entry
PAU_01766         CDS       T00941                                 

Gene name
mdtC
Definition
(GenBank) multidrug resistance protein mdtc (multidrug transporter mdtc)
  KO
K07789  multidrug efflux pump
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02020  Two-component system
Module
pay_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAU_01766 (mdtC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01766 (mdtC)
Transporters [BR:pay02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   PAU_01766 (mdtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF Patched
Motif
Other DBs
NCBI-ProteinID: CAQ83858
UniProt: C7BTK3
Position
complement(1990753..1993839)
Genome map
AA seq 1028 aa AA seqDB search
MKFFALFIQRPVATTLLSLAITLCGLLGFTLLPVSPLPQVDFPVITVYASLPGASPETMA
SSIATPLERALGRIAGVNEMTSSSSLGNTNITLEFDLSRDINSAARDVQAALNAAQNMLP
SGMHSRPRYYKANPSDAPIMILTLTSDTYNQGQLYDLASTQLAQKIAQVEGVSEVSVGGS
SLPAVRIELNPNALFNQGVSLDTVRQAISNANVRRPQGYVDSDQQRWQIQTNDELKTAES
YRPIIVHYKNGSPVRLQDVANIKDSVQNVRAAGMSGGEPAILLIIRREAGANIIATVNRI
REQLPALRESIPASIQLKVAQDRTPTIRASLAEVEHALVIATGLVILVVFLFLRSGRATL
IPAIAVPVSLIGTFTAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGIKP
MQAALRGVQEVGFTVLSMSISLVAVFIPLLLMDGLVGRLFREFAITLTTAIGISLLVSLT
LTPMMCAHLLKSQHIKAQKKIRGFGKVMLKIQQGYGRSLTWVLNHSRWVLLILAGIIALN
VWLYINIPKTFFPEQDTGRLLGFVRADQSISFQSMHEKMKNFMQIINADPAVDNVTGFTG
GWQVNRGFMFISLKPLKERSNNAEQVISRLRIKLANEPGANLFLIPVQDIMAGGRQSNAS
YQFTLLADDLNDLRKWEPVIRKALGQLPQLADVNSDKEDKGAEMAITYNRDTMSRLGINV
SEANSLLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDVSALEKMFIINNKGEAIPLSY
FAHWQPANAPLSVNHQGLSAASTISFNIPEGYTLSDAINAIERTITELGVPPTVRGTFAG
TAQIFQETVKSQLFLILAAIITVYLVLGILYESYIHPLTILSTLPSAGIGALLALELFNT
PFSLIALIGIMLLIGIVKKNAIIMVDFAIEAQRNGNICARNAIFQASLLRFRPILMTTLA
ALFGALPLVLSNGDGAELRQPLGITIVGGLVMSQLLTLYTTPVVYLCFDRLRERWQQRRA
TRQITGQS
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttttttgctttatttatccagcgccctgttgccacaacgctgctcagtttagct
ataaccctatgcggattattaggttttaccctattgccggtttcccctttgccgcaagtg
gatttcccagtaatcaccgtttatgcctcattaccgggagcatcaccggaaacaatggca
tcatctattgctactccgctggagcgggcattaggccgaattgccggtgtcaatgagatg
acgtccagtagttcacttggcaatacaaatatcacgcttgaatttgacctgagccgtgat
attaatagcgccgcacgggatgtacaggcagccctaaatgccgctcaaaatatgttaccc
tccggtatgcacagcagaccacgttactacaaagcaaatccgtccgatgcccccattatg
atcctgacactgacttctgatacctacaatcaggggcaactttatgatttagcgtctact
caactcgcccagaaaattgcacaagtcgaaggagtcagtgaagtttctgttggaggaagt
tctctacccgcggtgaggattgaattgaatcctaacgctctgtttaatcaaggtgtttct
ctagatacagtgcgtcaagctatcagcaatgcaaatgttcgccgcccacaaggatatgtg
gattcagatcagcaacgctggcagatccaaaccaacgatgaactgaaaaccgctgaaagt
tatcgcccgataatcgtccactacaaaaacggctcacccgtgcgactacaagatgtagcg
aatataaaagactcggttcagaatgtcagagcagccggtatgtctggcggtgagccagcg
attttacttatcattcgccgtgaagctggcgcaaatatcatcgccacggtaaaccgtatt
cgtgaacaattacctgcattacgtgaatccatccccgcttctattcaacttaaagttgct
caggatcgtacaccaactattcgcgcttcattagcagaagtggagcatgcgctggtaatt
gctaccggactagtcattttggtggtattcctgttcctgcgttctggccgagcaacatta
atcccagcgattgccgtacctgtttcactcattggaacttttaccgccatgtatttgtgc
ggttttagccttaacaatctttccctgatggcactgacgattgcaacaggattcgtcgtt
gatgatgctattgtggtattggaaaacatttcccgtcaccttgaagcaggtattaaacct
atgcaagcagcgctacgaggtgttcaagaagtgggctttaccgtcctttccatgagtatt
tcgctggtcgcggtctttatccctcttctgctcatggatgggttggttggtcggctgttc
cgtgaatttgctattactctaacaacagcaatcggtatctcgttgttggtctctttaaca
ttgactccaatgatgtgtgctcacttgctgaaatcccaacacatcaaagcccagaaaaaa
atccgcgggtttggcaaggtcatgctaaaaattcagcaaggttatggacgctccctaaca
tgggttcttaatcatagtcgctgggtactgttaattctggctggcattatcgccctaaat
gtttggctctatatcaatattccaaaaactttcttcccagaacaggatactggccggttg
ttaggatttgtccgagcagatcaaagtatctctttccagtctatgcatgaaaaaatgaaa
aattttatgcagataatcaatgccgacccggcagtagataacgttaccggttttactggc
ggctggcaggtaaaccgaggttttatgtttatctctttgaagccgctaaaagagcgctca
aacaatgctgaacaagttatttcacgcctgagaatcaaacttgctaatgagccaggggca
aatctgtttctaattccagtacaagacatcatggcgggtggtcgtcaaagtaatgcaagc
taccagtttacattactggcagatgacctcaatgatctacgcaaatgggaaccggttatt
cgtaaagcattaggacaattgcctcaattggccgatgtgaattcagataaagaagacaaa
ggcgctgaaatggcaataacctataaccgcgataccatgtcacggctgggaattaatgtc
agtgaagcaaatagcttactaaataatgcttttggtcagcgacaaatatctactatttat
cagccactgaatcagtacaaagttgtaatggaagttgcaccggaatatacacaagatgtc
agtgcattggaaaaaatgtttattattaacaataaaggagaggcaattccactttcctat
tttgctcactggcagcccgctaatgcgccgctaagtgtgaatcatcagggactctctgct
gcttctaccatttcctttaacatacctgaaggttataccctctccgatgctatcaatgct
attgaaaggaccatcactgagcttggtgtacctccaactgttcgcggcacttttgcaggc
actgctcaaatttttcaagaaacagtgaaatcacagttattcctgattctggctgcgatt
atcaccgtctatctggtgttaggaatattgtatgaaagttatatccacccactgactatt
ctttctaccttaccttctgccggtattggtgctctgttggcattagaactatttaacact
ccattcagcctgatagccttaataggcatcatgttgttgattggtatcgtgaaaaaaaat
gccattattatggtggattttgccattgaagctcaacgtaacggcaatatctgtgctcgt
aatgcgatattccaagctagcctgttacgtttccgcccaattctgatgactacactcgcc
gccttgtttggtgccctgccattagttttgagtaacggcgacggcgcggaattgcgccaa
ccattaggcattaccattgttggtggcctggtcatgagccaacttttgacactatatacc
acaccggtggtttatctttgttttgatcgattaagagaaagatggcaacaacggcgcgcc
accagacaaattacgggacaatcatga

DBGET integrated database retrieval system