KEGG   Photorhabdus asymbiotica: PAU_01769Help
Entry
PAU_01769         CDS       T00941                                 

Definition
(GenBank) transposase, is630 family
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_33 HTH_29 HTH_23 DDE_Tnp_ISAZ013 rve_3 HTH_40 HTH_28
Motif
Other DBs
NCBI-ProteinID: CAQ83861
UniProt: C7BHQ1
Position
1998669..1999721
Genome map
AA seq 350 aa AA seqDB search
MRFRVSVMKIFITDEQKAELEHLHHTCRDKRECDRIKAVLLASEGWSSVMIAQALRLHEM
TVNRHISDYLNHRKLKPDNGGSQSHLSETQTKELIAYLTANLLPTTQAVIHLVKEAWNIS
YTVPGMNKWLHHNGFSYKKPTGVPHKFNAEQQRAFIETYGKLKQEAGDNEPILFIDGVHP
TQGTKLAYGWMRKGQKTVVKTTGSRTRLNLMGALNLADISKTVVHEYDRIDSYHIAEFFI
ALRETYPVSQKVHIILDGAGYHRSELVKDWAYVMNIELHYLPPYSPNLNPIERLWKVMNE
QVRNNRYFASAALFRQAIHHFFTEILPELAGSLSRRINDNFQILNPASSS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcagggtatccgtcatgaaaatattcattaccgacgaacaaaaagccgaactt
gaacaccttcatcacacctgccgtgataagcgggagtgtgatcgtatcaaagcggtcctg
ctggcctctgagggctggagctctgtcatgatcgctcaggccctgcgcctgcatgaaatg
accgttaatcgtcatatcagcgattaccttaatcaccgcaaactcaagcccgacaatggc
ggctctcagagccacctcagcgaaacacagacgaaggaacttatcgcttatctgaccgcg
aatcttctgcccaccacacaggcggttatccaccttgtcaaagaagcgtggaatatcagt
tacaccgttcccggcatgaataaatggctgcaccacaatggatttagttataaaaaaccg
accggcgtgccacacaagttcaacgcggaacagcagcgggcctttatagaaacctacggg
aaactcaagcaggaagccggagacaatgagcccatcctgttcattgatggcgtccatccc
actcaggggacgaaactggcttatggctggatgcgtaaaggccagaaaaccgtagtgaaa
accacgggaagccgtacccgtctgaacctgatgggagccctgaatctggccgatatcagc
aaaacagtcgtacacgaatatgatcgtatcgacagttatcacatcgcagaattcttcatt
gccctgcgtgaaacctatccggtcagtcagaaggttcatattatccttgacggagccggt
tatcaccggagtgagttggtgaaagactgggcttatgtgatgaatattgaacttcattac
ttaccgccctacagcccaaatctgaacccgatagaaaggctgtggaaagtgatgaatgaa
caagtcagaaataatcgttacttcgcctcggcggccttgttcaggcaggcaatacatcac
ttttttacggaaatattaccggaacttgccgggagtctgtcacgccgtattaatgacaat
tttcagattctgaatcctgcatcttcaagttaa

DBGET integrated database retrieval system