KEGG   Photorhabdus asymbiotica: PAU_01771Help
Entry
PAU_01771         CDS       T00941                                 

Definition
(GenBank) adenosine deaminase (adenosine aminohydrolase)
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00230  Purine metabolism
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAU_01771
Enzymes [BR:pay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     PAU_01771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-ProteinID: CAQ83863
UniProt: C7BTK8
Position
2001113..2001787
Genome map
AA seq 224 aa AA seqDB search
MSFNPDLLKKVELHTHLDSGLSYHFIKKLVPDITPWAFCKKYIAPEKCRDLGDFLGKISP
SLDLLQKKDVIADAVEDLFIQLKKDNVVYVEIRFAPLFHLRLGLSDRDIVETVIEAMRNT
SVKYGIEASLILCTLRHFSEDQSLRTAYLVNEYCNYGVVALDLAADEAKYPLNAHLNAFR
IVLENGGNVIAHAGEAKGAESVSETIPYGFQDASRRPGSESPGA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatcctgatttactgaaaaaagtagagttacatacgcaccttgattctggg
ttgagttatcattttattaaaaaacttgttcctgatattacaccgtgggcattttgtaaa
aagtatatagcccctgaaaaatgtcgtgatttaggcgattttttgggtaagatcagtcct
tcattagatttactgcaaaaaaaggacgtaatagctgatgctgtcgaagatctttttata
caattaaaaaaagataatgtagtctatgttgaaattagatttgctcctttatttcatctt
cgtttgggattaagtgaccgcgatattgtcgaaactgttatcgaggcaatgagaaatact
tcggttaaatatggtatagaagcaagtttaatattatgtacattgcggcatttttcagag
gatcaaagtttgagaacagcatatcttgttaatgaatactgtaattatggtgttgttgct
ctcgatcttgctgccgatgaggcaaaatatccactcaatgctcatttgaatgcatttaga
atagtattggaaaatggtggtaatgttattgcccacgcgggagaagctaagggggctgaa
agtgtgagtgagactataccctatggatttcaagatgcatcgcgacggccagggagcgaa
tccccgggagcatag

DBGET integrated database retrieval system