KEGG   Photorhabdus asymbiotica: PAU_01772Help
Entry
PAU_01772         CDS       T00941                                 

Definition
(GenBank) adenosine deaminase (adenosine aminohydrolase)
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-ProteinID: CAQ83864
UniProt: C7BTK9
Position
2001796..2002188
Genome map
AA seq 130 aa AA seqDB search
MTGVSECSQQRGNLKDDRYINKLNVSRIGHGVRSIEDQDVIDLIIERNIHLEICPTCNIV
CDVYDVYESHPVNLLKRIGVNIGINTDTRTVANITLCEEYLKINRYFDWQYIPNRFRVAA
RRQVNESPGT
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggggtgagtgagtgcagccaacaaagaggcaacttgaaagatgacaggtatatt
aataaattaaatgtttctcgtataggtcatggtgtaagaagcattgaagatcaagatgtt
attgatcttattatagaaaggaatatacatctagaaatatgccctacatgtaatattgtt
tgcgatgtttatgatgtctatgaaagccatccagttaatttgttaaaacggattggtgta
aatattgggattaatacggataccagaacagttgcaaatataactttatgtgaagaatat
ttgaagattaatcgatattttgattggcagtatatacccaatagatttcgagttgcagcg
cgacggcaagtgaacgaatccccaggaacatag

DBGET integrated database retrieval system