KEGG   Photorhabdus asymbiotica: PAU_01774Help
Entry
PAU_01774         CDS       T00941                                 

Definition
(GenBank) similar to transcription regulator
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 HTH_11 HTH_36 HTH_29 HTH_24 GntR HTH_23
Motif
Other DBs
NCBI-ProteinID: CAQ83866
UniProt: C7BTL1
Position
2002535..2003182
Genome map
AA seq 215 aa AA seqDB search
MKNYISKYHLNSIFLPELIKELDIVEIEKNAYLTYQSSKFTHLYILVDGKLKVEFCNVDG
KFFVFTFATPLFLVGDLELFHARKNSFINTISAQEHSVLLSIPLAAVKIFGLNDPCFLEF
VCNQLSNKLFESSLFQTGVFLNVEEKLKRFLYYNSKKNGSLFSLEKRENLASVLGVSVRQ
LNRAIKSLNEKGIIISKNKKVKIIDYCSLENNIES
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattatattagcaagtatcaccttaatagtatttttttaccagaacttattaaa
gaattagatattgtggaaattgaaaaaaatgcttatcttacgtaccagtcgtcaaagttc
actcatctatatattctggttgatggtaaattaaaggttgaattttgtaatgttgatgga
aaattctttgtttttacatttgccactcccctttttcttgtaggagatttagagcttttt
catgcccgaaaaaatagcttcattaatactatctctgctcaagaacattcagtgcttttg
tcaattccattggcagcagtgaaaatttttggattaaatgatccttgttttcttgagttt
gtatgtaaccaactcagtaataaactttttgagtcttctttatttcaaactggggtgttt
cttaatgttgaagaaaaattaaagagatttctttactataattcgaaaaaaaatggatct
ttattttcattagaaaaaagagaaaatttagcatctgttttaggtgtttcagttaggcaa
ttaaatcgagctattaagagcttaaatgaaaaagggataattatatcaaagaataaaaag
gttaaaatcattgattactgttcactggagaataatattgaatcttaa

DBGET integrated database retrieval system