KEGG   Photorhabdus asymbiotica: PAU_01775Help
Entry
PAU_01775         CDS       T00941                                 

Gene name
yfgG
Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2633 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: CAQ83867
UniProt: C7BTL2
Position
complement(2003584..2003745)
Genome map
AA seq 53 aa AA seqDB search
MKKKKRSQITKLILLISFLILFGRFTYSSIAALDHHQKNKQTTPEKIGNHQMK
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaagaaacgatctcaaattaccaaactaattttacttatcagttttctaatt
ttattcggtcgttttacttattcatctattgcggcattggatcatcatcagaaaaataaa
cagactacaccagagaaaatcggaaatcatcaaatgaaataa

DBGET integrated database retrieval system