KEGG   Photorhabdus asymbiotica: PAU_01780Help
Entry
PAU_01780         CDS       T00941                                 

Gene name
purM
Definition
(GenBank) phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00230  Purine metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01130  Biosynthesis of antibiotics
Module
pay_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAU_01780 (purM)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     PAU_01780 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: CAQ83872
UniProt: C7BTL7
Position
complement(2008720..2009760)
Genome map
AA seq 346 aa AA seqDB search
MTNKTSLSYKDAGVDIDAGNALVDRIKGVVKQTRRPEVMGGLGGFGALCALPQKYREPIL
VSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAA
SVITGIAEGCKLSGCALVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVQAGDA
LIALAASGPHSNGYSLIRKILSVSNTNPEATELEGKPLADHLLAPTKIYVKSVLSLIEKV
DVHAIAHLTGGGFWENIPRVLPENTQAQINESSWQWPAIFHWLQQTGNVSRHEMYRTFNC
GVGMVIALPQTVAEHAVELLNAAGEKAWQIGTIATLKAGEQQVVIK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacaaaacctctcttagctataaagatgccggtgtagatattgatgctggtaat
gccttagtagaccgtattaaaggtgttgtaaaacagacccgtcgtccagaagtcatgggc
ggtttaggtgggtttggtgctttatgtgcattaccacaaaaataccgtgaacccattcta
gtttccggtaccgacggtgttggtaccaagttacgtctggcaatggatctcaaacgtcat
gacactatcggcattgatttagttgcaatgtgcgttaatgacctggttgtccaaggtgca
gaacctctgttcttccttgattattatgcaactgggaagctggatgttgatacagcagcc
agtgttatcaccggtatcgcagaaggttgtaaattatctggctgtgctctggtgggcggt
gaaaccgcagaaatgccaggaatgtatcatggtgaagattacgatgttgctggcttctgt
gttggtgtcgttgaaaaatcagaaatcattgacggcagcaaggttcaggcgggtgatgct
ctgatcgctctagccgccagtggtccacactcaaacggctattctctgatacgcaaaatt
ctgtcagtcagtaatacaaacccagaagcaacagagcttgaaggcaaaccactggcagat
cacctacttgccccaacaaaaatttatgttaaatccgttttatccctgattgaaaaagtt
gacgttcacgctattgctcacctgacggggggtggtttctgggaaaatatcccgcgtgtc
ttgcctgaaaatacccaagcacagattaatgaatccagctggcaatggcctgcaatattt
cactggctacaacaaaccggtaacgtcagccgtcatgaaatgtatcgtacattcaactgt
ggtgtcggcatggtgattgcactaccacaaacagtagcggaacatgctgttgaattgctc
aatgcggctggtgaaaaagcctggcaaatcggtacaattgctacactgaaagcaggtgaa
caacaggttgttattaaatga

DBGET integrated database retrieval system