KEGG   Photorhabdus asymbiotica: PAU_01784Help
Entry
PAU_01784         CDS       T00941                                 

Definition
(GenBank) hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ83876
UniProt: C7BTM1
Position
complement(2012504..2012926)
Genome map
AA seq 140 aa AA seqDB search
MGYGEAHISDFKVSGVEYTLIIMEIISKGDSSVVLPENYRLDLSRFFEVSFDAKNNLDSN
TLFARYPTNNHDQMTGIMHKVERLINEHYNAVSPSGYVLLAADERLNKVYKRYIHRFVTQ
NSFTMTDKLGPNGRGYVIHT
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgggatatggcgaagcacatatctcagattttaaggtgtctggcgtggaatataccttg
attataatggaaattatctcaaagggagattcctctgtcgttttacctgaaaattacaga
ctcgacctaagtcgcttttttgaggtttcatttgatgcaaaaaacaatttagacagtaat
acactatttgcgagataccccacaaataaccacgatcaaatgacagggattatgcataaa
gttgaaaggctgattaatgagcactataatgcggttagtcctagtggatacgttttgcta
gccgcagatgaacgactcaacaaggtttataaacgatatattcatcgatttgtgacacaa
aatagctttaccatgacagataagttaggcccaaacgggaggggttatgtcatccataca
taa

DBGET integrated database retrieval system