KEGG   Photorhabdus asymbiotica: PAU_01785Help
Entry
PAU_01785         CDS       T00941                                 

Gene name
celF
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_01785 (celF)
   00500 Starch and sucrose metabolism
    PAU_01785 (celF)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAU_01785 (celF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CAQ83877
UniProt: C7BTM2
Position
complement(2013192..2014499)
Genome map
AA seq 435 aa AA seqDB search
MKQIKIAVIGGGSSYTPELVEGLIQRHKSIPLSELALVDIDSGKQKVEIIAALTRRMLAR
HGLDHVIVSVHFTLDNAIRGASFILTQLRVGQLPARAADERLGLKYGLIGQETTGVGGFA
KALRTIPVLLDIAHRVEQLAPEAWVINFTNPAGIVTEAISRYSKVKVIGLCNVPVTMHHM
IANMLQRPYQDVQLHFAGLNHMVWVHQVLVSGRDETQRVLDMLCNGAALTMNNIKEAPWP
PPLLKALGAIPCPYHRYFYQTRNMLQEEREAAAKQGTRAEQVMQVERELFKLYSDPELNH
KPEQLSFRGGSFYSEVALDLICAIHNNLNSQLVVNTANHGTIRGLPDDAVIETNCIINAE
GAHPLTFGRLSDSMYSLTQQIKTYERLTIKAAVHGDRDAALLALITNPLVADTDIASPLL
DDVLAINRDYLPQFQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcaaaatagccgttattggcggtggtagtagctacacacctgaattagtc
gaagggcttattcagcgccacaaaagtattccgctatccgaattggcgttagttgacatt
gacagcggaaaacagaaagtagaaatcatcgctgcacttacccgccgaatgttagcccgt
catggcctggatcacgttatcgtcagcgtacatttcacattagataatgcaattcgcggt
gccagttttattttgactcaattacgtgttggccaacttccggcacgcgcggcagatgaa
cgtctggggttaaaatatggcttgatcggccaggaaactaccggcgtaggtggattcgcc
aaagcattacgcaccattcccgttttgctggatatcgcccaccgagttgagcaacttgca
ccagaagcatgggttattaactttaccaatccagctgggatcgttaccgaagcaatttcc
cgttatagcaaggtaaaagttattggcctatgtaatgtcccggtcaccatgcatcacatg
atagccaatatgctgcaacgtccctaccaagatgtacagctacactttgcgggacttaat
cacatggtctgggtacatcaggtgttggtttcagggcgagatgaaactcagcgggtgctt
gatatgctatgcaatggtgcagctttaaccatgaataatattaaagaagcaccttggccc
ccaccactacttaaggcattaggcgcaatcccttgcccttatcatcgctacttctaccaa
acccgcaatatgttacaggaagagcgagaagccgccgccaaacaaggcacacgggccgaa
caggtcatgcaagtagagcgggaactatttaaactgtattctgatccagaacttaaccac
aaaccagaacaacttagtttccgtggtggttcattctactctgaggttgctctggatctg
atttgcgccattcataataacctcaacagccaattagtggtcaatacggctaaccacggt
actattcgaggtctgccggatgatgcggtcattgaaaccaactgtattattaatgcggaa
ggcgctcacccactcacgtttggtcgcctgtccgacagtatgtattctttgacacaacaa
ataaaaacctacgagcgtttaacgattaaagcagcagttcatggtgatcgtgacgctgca
ctattagcactgatcaccaacccactggttgccgatacagacattgcttcaccactactg
gatgatgtattggcgatcaatcgtgattatttgccacaatttcaatga

DBGET integrated database retrieval system