KEGG   Photorhabdus asymbiotica: PAU_01787Help
Entry
PAU_01787         CDS       T00941                                 

Gene name
celB
Definition
(GenBank) phosphotransferase system cellobiose-specific component iic
  KO
K02761  PTS system, cellobiose-specific IIC component
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00500  Starch and sucrose metabolism
pay02060  Phosphotransferase system (PTS)
Module
pay_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAU_01787 (celB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    PAU_01787 (celB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01787 (celB)
Transporters [BR:pay02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    PAU_01787 (celB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC
Motif
Other DBs
NCBI-ProteinID: CAQ83879
UniProt: C7BTM4
Position
complement(2014835..2016163)
Genome map
AA seq 442 aa AA seqDB search
MNLYASFMRVLEHYIIPFAGKIGNQRHIIAMRDGFISAMPFLIIGSMMLIMANPPFDSQT
SSSFGQVWLSFAKTHWDTITMPYFMTMGLMSIFVSAGTAYSLAKSYGLDGLTSALLSLMA
FLLAAAPQIENKIALDFLGGTGVFTSLICAIWSVELTRLLKKYNITIRMPTQVPPAIARS
FELLYPVIGILLTVYPASLLLQSEFNLLIPAAIMQMFQPLISVSDTLPAIMLTLFIANLL
WFAGIHGANIVTGLMTPIFIANLATNATLTAQGIAPTQILTDPYWSFYVCIGGSGSTLVL
AILYLRSRSMHLRTIGKLSVVPVMFNINEPLLFGSPIVMNPALFIPLLVVPLVNAVLSYS
ALHLDFVHKMVAISPWTTPAPLGAMISAAWDYRSAVLVIILIIIDLFIWYPFFKIYEKQL
VNEESKQQENTESIEVKTRSQP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttacgcatctttcatgcgtgttttagaacactacattatcccgtttgccggg
aaaatcggtaatcagcgacatattattgcaatgcgtgatggcttcatctcagccatgcca
tttttgatcatcggcagcatgatgctgattatggcaaacccaccattcgattcacaaact
tcatcctcattcggccaagtttggttatcctttgctaaaacgcactgggataccatcact
atgccttattttatgacgatgggattaatgagtatttttgtctcagctggtactgcctac
agcttagctaaatcctacggtttggacgggttaacttctgctttactctctctaatggca
tttttgctagccgcagccccacagatagaaaacaaaatagccctcgacttcctcggtggc
acgggtgtatttacctcattaatttgcgctatctggtcagttgaactgacgcgcttatta
aaaaaatataacatcaccatccgaatgccgacacaagtaccaccagcaattgcccgttct
ttcgaacttttgtacccagtcataggtatcctgttaaccgtttatcctgctagcttgcta
ttgcagagtgaattcaatctacttattcccgctgctataatgcaaatgttccaacccctt
atttccgtcagcgatactctgcccgccattatgctgacactattcattgctaacctactg
tggtttgctggtattcatggcgccaatatcgttactggcctgatgacacctatttttatt
gccaatcttgctaccaatgcaacattaacggcgcaaggtattgcgccaacacaaattctt
actgatccttactggtcattttatgtatgtattggcggttctggttctacactagttctg
gctattctttatctgcgtagccgttctatgcacttacgtacaatcggaaaactgagtgta
gttccagtcatgttcaatattaacgaacctttgttatttggttcaccgattgttatgaat
ccagccctatttattccgctattggttgtaccattagtcaatgcagtattgtcctacagc
gctctgcatcttgactttgtacataaaatggtcgccatctcgccctggaccactccggcc
ccccttggtgcaatgatttctgccgcctgggattaccgctcggcagtactggttatcata
ttaataataatcgatctattcatctggtatcccttcttcaaaatttatgaaaagcaatta
gtcaatgaagaaagtaaacaacaagaaaacacggaatccatcgaggtaaaaactcgctct
caaccataa

DBGET integrated database retrieval system