KEGG   Photorhabdus asymbiotica: PAU_01796Help
Entry
PAU_01796         CDS       T00941                                 

Gene name
dapA
Definition
(GenBank) dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00261  Monobactam biosynthesis
pay00300  Lysine biosynthesis
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01230  Biosynthesis of amino acids
Module
pay_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PAU_01796 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PAU_01796 (dapA)
Enzymes [BR:pay01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     PAU_01796 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS Arylsulfotrans
Motif
Other DBs
NCBI-ProteinID: CAQ83888
UniProt: C7BGW6
Position
2022484..2023383
Genome map
AA seq 299 aa AA seqDB search
MFSGSFEFTGSIVALVTPMNANGHVDKVSLKKLVDYHVASGTSAIVSVGTTGESATLSHD
EHGDVVLTTIELADGRIPVIAGTGANATAEAISLTKRFENSGVVGCLTVTPYYNKPSQEG
LYQHFKTIAENTDLPQILYNVPSRTGCDLLPSTVARLAKIKNIVAIKEATGNLNRVSQIQ
ELVNDDSFILLSGDDASGLDFIQLGGKGVISVTANIAAPEIAKLCELALSGQFTEARKLN
NRLMDLHHQLFVEPNPIPVKWGCHKLGLIADDTVRLPMTPLTDAGKVSVEKALRMAGLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcgggagctttgaattcacaggcagtattgttgcgctggtgacaccaatgaat
gcaaatggtcatgttgataaagtcagcttgaaaaagttagtcgattatcatgttgccagt
ggtacatcggctatcgtttcggtaggaacaacgggagaatcggccacattaagtcacgat
gaacacggtgatgttgttttgacaaccatcgaactggccgacggacgtattccggtaatt
gctggaacaggtgcaaatgcgactgctgaagcgatatccctgacgaagcgttttgaaaat
agtggtgttgttggttgcttgacggtaacaccttattataataagccctcacaggagggg
ttatatcagcattttaaaactatcgctgaaaatactgacttgccacaaattctgtataat
gtgccttctcgtactggatgtgatttgctgccgtcaactgtagctcgtttggcgaagatt
aaaaatattgtcgcaattaaagaagcgacagggaacttaaatcgcgttagtcaaatccaa
gagttggttaatgatgatagtttcatcttattgagcggtgatgatgcaagtggattggat
tttatccagcttggaggaaaaggggtaatttctgttactgcaaacattgcagcgcctgaa
attgccaagctctgtgaattggcattaagcggtcagtttacagaagcgcgtaagctgaat
aaccgtctgatggatttacaccatcagttatttgttgaacctaacccaattccagttaaa
tggggatgtcacaaattaggtctgattgctgatgacactgtgcgtctgcccatgacgcca
ttgacagatgcaggaaaagtctcagtcgaaaaagccttgagaatggccggattactgtaa

DBGET integrated database retrieval system