KEGG   Photorhabdus asymbiotica: PAU_01798Help
Entry
PAU_01798         CDS       T00941                                 

Gene name
purC
Definition
(GenBank) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00230  Purine metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01130  Biosynthesis of antibiotics
Module
pay_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAU_01798 (purC)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     PAU_01798 (purC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-ProteinID: CAQ83890
UniProt: C7BGW8
Position
2024542..2025255
Genome map
AA seq 237 aa AA seqDB search
MQKKAELYRGKAKTVYTTDDPDRLILEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMNK
LEEAGIPTQMERLLSDTEVLVKKLDMVPVECVIRNRAAGSLVRRLGVEEGLVLSPPLFDQ
FLKNDALHDPMVNESYCETFGWVSKEHLAEMKNLSYKANEILSKLFDDAGLILVDFKLEF
GLFKGQIVLGDEFSPDGCRLWDKETLDKMDKDRFRQSLGGLIEAYEEVAHRIGVVLD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaagctgagttgtatcgtggcaaggcaaaaacggtgtacaccactgatgat
cctgatcggctaattttggaattccgtaatgatacatcggcgttggatggtgaacgtatt
gaacagttcgaccgcaaagggatggtgaataacaaattcaatcatttcattatgaataag
ctggaagaagcgggtattccaacgcaaatggaacgcctgttatcagacactgaagtactg
gtcaaaaagctggatatggtgccagttgagtgtgttatccgtaatcgggctgccggttcg
ttagtcagacgccttggggttgaagaaggtttagtattgagtccccctctgttcgatcag
tttctcaaaaatgatgctctgcacgatccaatggtgaatgaatcctattgtgaaactttt
ggttgggtcagtaaagaacacctggctgaaatgaaaaatttgagctacaaggccaatgaa
atattgagcaaattgtttgatgatgctggtttgattttggttgatttcaaacttgagttt
ggtttatttaaagggcaaatagttctgggtgatgaattttctcccgatggttgtcgttta
tgggataaagagactttggataaaatggataaagaccgtttccgccaaagtcttggtggt
ctgattgaagcgtatgaagaagtagcgcaccgtattggtgttgttttagattaa

DBGET integrated database retrieval system