KEGG   Photorhabdus asymbiotica: PAU_01799Help
Entry
PAU_01799         CDS       T00941                                 

Definition
(GenBank) lipid A export ATP-binding/permease protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane MMR_HSR1 DEAD SMC_N AAA_23 AAA_21 AAA_29 RsgA_GTPase FtsK_SpoIIIE Dynamin_N DUF87
Motif
Other DBs
NCBI-ProteinID: CAQ83891
UniProt: C7BGW9
Position
2026016..2027743
Genome map
AA seq 575 aa AA seqDB search
MENIMSKNLTAWQILLRSAIPFKGTVMCAFLALTVTLLCDLGGPYIIRNYVDKATSGTTA
DQLIMLAIIYLFIASIGVMGSLVTSYMSTKAGWGIADTIRYKLFHHVMTVLPVLEIERRS
QGELLESVEGNADIIGKTISKAGFKAIGNSALALGTLIIIFNVMPQAGIAMAIVIILVAY
VLIQLTRLAVRRWLIARTEKARIFGFIGDSLHAMDDLQPLSQAHWPSVAFRKMLSVLLKI
ERKAYIGGRAFWPITQLFFALCFGIGFGFGLQLLGQDSISIGTLTMVYLYVDKLREPVED
MSQEIELLQKLFAALSLAAKTLSEGTASKSPDNLLPDGPLSIHFDNVDFSYGGEETQVLH
SVNFYVAPGSKIGIIGRTGAGKSTILNLMCGFAQPDSGRVTIGNIDVSTIRPEEFAKKVA
VLSQRSHLFSATLRENLTLFSNEISDGQIWAVLQELDALEWAKALPDGLNTLVGTNGRIM
SEGEIQMIAGARVMLQHCSLVIIDEGTSQLDPQTEESWLKLLGKLSRNRTVVMVAHRLHT
LSAVDEIIIIDDGRIKQRVPETEIAMLTSNHGLIV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacattatgtcaaagaatttaaccgcatggcagatactgttacgtagtgccata
ccgtttaagggaacggttatgtgtgcctttctggccttaaccgtcacattattatgcgat
ctaggtggcccctatattataaggaattacgtcgataaggcgacgtcaggaaccactgct
gatcagcttattatgttggcaataatttatcttttcatcgcctcgattggggtcatgggt
agtttggtcactagctacatgagcaccaaggctggttggggtattgcagatactattaga
tacaaactttttcatcatgtgatgacggttttacccgtattggaaatagagagaagatcg
cagggagagctgttggaaagcgtcgaaggaaacgctgacattataggaaaaacgatttct
aaagctggtttcaaggctattggtaattcagcactggcactcggtacattaatcattata
ttcaatgtcatgccccaggcgggcattgctatggctattgttattatattggtggcatat
gtacttattcaattaaccagacttgctgttcgtcgttggctcattgcgcgaacggagaaa
gcaaggatctttggttttatcggtgattcactccatgcaatggatgatttgcagccatta
tctcaagcccattggccttccgttgcatttcgtaagatgttgtcagtattactcaaaatt
gaacgcaaggcttatatcggcggtagggctttctggccaattactcagctcttttttgca
ttgtgcttcggtataggttttggctttgggcttcagttacttggccaagacagtataagt
atcggcacattaacaatggtctatctctatgttgacaagctgcgagagccagtggaagac
atgtcacaagaaatagagttgctacagaagttatttgctgctttatcacttgcggctaaa
acgctaagtgaaggtactgcaagtaaatcaccagataatctattgcctgatggccctctc
tctatccatttcgataatgttgatttcagttatggtggggaagaaacacaggttttgcat
agcgttaatttttacgttgctccggggagcaaaattggcattatcgggagaacgggagca
ggaaaaagcactattcttaatttgatgtgtggatttgcgcagcctgattcgggaagagtg
acaattggaaatattgatgtctcaacaattagacctgaagaatttgcgaaaaaggttgcc
gtgcttagtcagcgttctcatttgttctctgcaacgttgcgggaaaatttaacactattc
agtaatgaaatatctgacggtcagatttgggctgttctgcaagaattagatgcgcttgaa
tgggctaaagcattaccggatggtcttaatacactcgtcggaaccaacggacggataatg
tcagaaggggaaattcaaatgatagcgggcgccagagtgatgttacagcattgctcgttg
gtgattattgatgaaggaacatctcaactcgatccgcagactgaagagagttggctgaaa
ttacttggaaaattaagtcgcaatcgcaccgtagtgatggtcgcacaccgtcttcataca
ctttcagccgttgatgaaatcatcattattgatgatgggcggattaaacagcgagttcca
gaaacagaaatcgcaatgttaaccagcaatcatggactcattgtatga

DBGET integrated database retrieval system