KEGG   Photorhabdus asymbiotica: PAU_01800Help
Entry
PAU_01800         CDS       T00941                                 

Definition
(GenBank) similar to abc transporter
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
pay  Photorhabdus asymbiotica
Brite
Transporters [BR:pay02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    PAU_01800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N cobW TsaE AAA_18 Pex24p AAA_23 MMR_HSR1 AAA_30
Motif
Other DBs
NCBI-ProteinID: CAQ83892
UniProt: C7BGX0
Position
2027740..2029383
Genome map
AA seq 547 aa AA seqDB search
MTISSVSTKPKMLSALIDLVKKFAPLYFITMFVWTLMHGFPLLIGYLISKLLDSAINEPT
NPTVWWLLSSAIAVMVLRSLVLFMGLSLDFTLIFKVSAYLKERVLRGVSHCSHNQRHAFS
QGDILNRIRDDSDEIAEFLSWTSDFIYRALLLIIALVVLINTDPITTLALMPMIVGLWIG
AILKRKVGNLQESKRQSQGDIAGQITDVLTGIRDLRLSNKIEGQIERLSQKFVSRRAIQA
KHQVFTDLLSGLFKNIVIIGTSAVLLIVSKRIVDGSFTVGNLALFLTYIGWISEQIFFFG
RSIANYKNADVCYERIKQLLADKREIKEDEQGEVLHKLSVNHLAYSNTQLPVSFEATTNQ
VVGIVGEMGAGKTTFLRYLIGLEKSSSGSVLWNNREVLGNENWWRNPRIGYARQRAGFFG
GTVRQNLALGDTDIDDDIMVQALEAVGMTPGSYELPEGLDTVINSGSARQLSGGQRQRLA
LARMLCRPADVYIVDNCDSSLDAVTARHLWSTLPERWPGLWIVVSCNADLLAKADHIVTV
QRRRELA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgactatatccagtgtatcaactaaacctaagatgttatcggcattgattgatttggtg
aaaaaatttgcccctctctatttcatcacaatgtttgtatggacacttatgcacggtttt
cctttgttgattggttacttaatcagtaagctactggatagtgcaataaatgaaccgact
aatcctacagtctggtggttactttcctctgcaattgctgtaatggttttgcgatcgcta
gttctcttcatgggattaagcctggactttacgttgatatttaaagtaagtgcttatttg
aaagagagagttttacgcggcgtgagccattgttctcataatcagaggcacgctttttca
caaggcgatattttgaatcgcattcgtgatgatagtgatgaaattgcggaattcttgagt
tggacttctgattttatctaccgggcattacttttaattatcgcattagttgtgcttatc
aacactgatccaataaccacgctggctcttatgccgatgattgtgggtctctggattggc
gcgatacttaaacgcaaagtaggtaatttacaagagagtaaacgtcaatcgcagggagat
attgcaggtcagattactgatgttttaacgggtatacgtgatctgcgccttagcaacaaa
attgaaggtcagattgagagattgtcgcagaaatttgtgagtcgacgggctattcaagcc
aaacatcaggtatttactgaccttctttctggcctgtttaaaaatattgtcataatcgga
acatcagcggttttattgatagtgagtaaacgaatcgttgatggcagttttactgtgggt
aatctggcgttatttttgacttatatcggctggatcagtgaacagatatttttctttggt
cggtctattgctaattataaaaatgctgatgtgtgttatgagcgcatcaaacagttattg
gcagataaaagagaaataaaagaagatgaacaaggtgaggttctccataagcttagtgtt
aatcatcttgcgtattcaaatactcagctccctgtttcatttgaagcgacaactaatcag
gtcgttggaattgttggggagatgggggcgggtaaaaccacctttttgcgttatttgatc
ggtttggaaaagtccagttctggcagtgtgctttggaataacagagaagttctggggaat
gaaaactggtggcggaatccacgtatcggatatgccagacaaagagcgggtttttttggt
ggaacagtaagacaaaatctcgcattgggcgatacggatattgatgacgatattatggtg
caggctttagaggcggtaggtatgactcctggctcatatgagctaccagaaggacttgat
actgtcattaattctggcagcgcccggcaactgtctggtggccagcgtcaacgtttggcg
ttggctcgaatgttatgtcgtcctgctgatgtttatattgttgataattgtgattcatca
ttagatgcagttacggctcgtcacttatggtccaccttgccggagcgttggcctggtttg
tggattgttgtttcatgcaatgctgatcttctcgctaaagctgaccatattgttactgtt
caacgacggagggagttggcatga

DBGET integrated database retrieval system