KEGG   Photorhabdus asymbiotica: PAU_01801Help
Entry
PAU_01801         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_38
Motif
Other DBs
NCBI-ProteinID: CAQ83893
UniProt: C7BGX1
Position
2029657..2029857
Genome map
AA seq 66 aa AA seqDB search
MVKIADYPQMKSCAWYLAEDTELTDRDALAFYERNWKYVEEDKLEPQERQLIERLIHEQG
HGFLNV
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaatcgctgattatccacaaatgaaaagttgtgcttggtatcttgctgaagat
actgagctaactgatcgtgatgctctggcattttacgagcgcaattggaaatatgtcgaa
gaagataagcttgaaccccaggaacgtcagttgattgaacgactcattcatgagcagggg
catggttttttaaatgtttaa

DBGET integrated database retrieval system