KEGG   Photorhabdus asymbiotica: PAU_01803Help
Entry
PAU_01803         CDS       T00941                                 

Gene name
entB
Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: CAQ83895
UniProt: C7BGX3
Position
complement(2031427..2031654)
Genome map
AA seq 75 aa AA seqDB search
MKNQLLYEILLREITTLHPEEKTIPADENLFDIGFDSIKMLMLVDRLKYAGYSVKFADLV
RWPTINDWINLIAKN
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaacttttatatgaaattttacttcgggaaatcacaactcttcacccagag
gaaaaaaccattccagcagacgagaatctttttgatattggtttcgactcgataaaaatg
ttaatgctggttgatcggttaaaatatgccggttattcagttaaatttgcagatttggtc
cggtggccgacaattaatgactggatcaatctaatcgcaaaaaattaa

DBGET integrated database retrieval system