KEGG   Photorhabdus asymbiotica: PAU_01809Help
Entry
PAU_01809         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF677
Motif
Other DBs
NCBI-ProteinID: CAQ83901
UniProt: C7BGX9
Position
complement(2039641..2040651)
Genome map
AA seq 336 aa AA seqDB search
MKRRTFIGVAAGAAIGSVIPTVNASIDSTRLFGVPRSLLSPGEIEENKLRLSMSNAKLPV
EVWEEIITYNRFWETIKQQPELALEYRESPEKVLDEFGIDKDIVSPGSAEELLLFITYDK
DLMNAVKTNDYEALFSRLKTYGLNEKGSSLRNRINYHLSQDANLVAHFKEHIESYQLQDT
DNPPLIRLKEILEPLNSEDDTSIEIARLVVGANVVAAVNVAVGTRVVAAVNAAAAVNVAA
YLSLAVQTVVTVCMANYLPKIDHSDLSTGTASLHLARLYNNQQMVDTLVKEAIRREITAC
LFAAQKCGYINLPATREERKEVIHLFTELSLGMAVA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacgcacatttattggtgtagctgctggagcagctattggcagtgtcatacct
accgttaatgccagtattgacagcactcgtctatttggcgtgccacgttcactactttcc
ccaggagaaatcgaagaaaataagctgagactgtcaatgtcaaatgccaaactcccggtt
gaagtttgggaagaaattattacctataaccggttttgggaaaccataaaacaacagcct
gaattagcattagaatatcgagaatcaccagaaaaagtgttggatgaattcggtatagac
aaagatattgttagccccggctccgctgaggaattactgctattcatcacgtatgataaa
gatttaatgaatgcagtaaaaaccaacgattatgaagcgctcttttcccgactaaaaacc
tatggtttaaacgagaaaggctcaagtctgaggaaccgaatcaattatcacctcagtcaa
gacgccaacctggttgcacattttaaagaacatatcgaatcctaccagctacaagataca
gacaatcctccacttatccggttaaaggaaattctggagcctttaaacagcgaagacgat
accagcattgagattgcccgcctggtagtcggagcaaatgtggttgctgcggttaacgtg
gctgtcggcaccagagtcgtcgcggcggtaaatgcggcggcggcggttaacgtagctgcc
tatttaagtctggcagtacaaacagtcgttactgtatgcatggcaaattatctacccaaa
attgaccatagcgacctttcaaccggtacggcttctcttcatcttgccaggctctataac
aatcaacagatggtagacacactggttaaagaagctatccggagggaaatcactgcctgc
ctgtttgctgcacaaaagtgtggttatatcaatttgccggcaactcgcgaagagcgtaaa
gaagtgattcatcttttcaccgaattatctttaggaatggcagtagcatga

DBGET integrated database retrieval system