KEGG   Photorhabdus asymbiotica: PAU_01813Help
Entry
PAU_01813         CDS       T00941                                 

Gene name
yeaL
Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF441
Motif
Other DBs
NCBI-ProteinID: CAQ83905
UniProt: C7BGY3
Position
2044219..2044734
Genome map
AA seq 171 aa AA seqDB search
MKYKEKSPWSSRLRQLRVLTFMSHIDPTLLVLLVLAALGIISHNLTVTLAMLFLLVIRIT
PLNQFFPWVEKYGLTVGVLILTVGVMAPIASGKITVQAVLNSFMHWKSLLAIVIGVLVSW
LGSRGVSLMSNQPSIVAGLLVGTVLGVAMFKGVPVGPLIAAGILSLLIGKS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaggaaaaatcgccctggtcgagtcgattaaggcagcttagggtattaacg
tttatgagccatatcgatcctactttactcgtgttgttggtgctggcagcgctgggtatc
atcagccacaacctgaccgtcactcttgcaatgttgttcctgctagttattcgtataacg
ccattaaatcagttcttcccgtgggtagaaaaatatgggttgacggttggtgtgcttatt
ttgactgtgggagtgatggcacctatcgccagtggaaaaatcactgtacaagcggttctt
aactcatttatgcattggaaatcgttattggcaatagtgataggtgtcttagtgtcatgg
ttgggcagtcggggtgtttccctgatgtctaatcaaccatcgatagtcgctggtttgctc
gtgggaactgtgctgggtgttgccatgtttaaaggtgttccggtcgggccgctgattgct
gcggggattttgtcattgctgattggtaaatcgtaa

DBGET integrated database retrieval system