KEGG   Photorhabdus asymbiotica: PAU_01814Help
Entry
PAU_01814         CDS       T00941                                 

Gene name
ypfI
Definition
(GenBank) putative acyltransferase
  KO
K06957  tRNA(Met) cytidine acetyltransferase [EC:2.3.1.193]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.193  tRNAMet cytidine acetyltransferase
     PAU_01814 (ypfI)
Transfer RNA biogenesis [BR:pay03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    PAU_01814 (ypfI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_bind_3 Helicase_RecD GNAT_acetyltr_2 DUF1726 AAA_30 Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: CAQ83906
UniProt: C7BGY4
Position
2044740..2046788
Genome map
AA seq 682 aa AA seqDB search
MLPELSAIQAEMQQQGLRRLLVLSGDHNWCHQQAHELQQEFMGDWLWISYRKEKAVLPEK
AAGLLGQEYLHGVFDATEGLNAEALAILAGTLKAGSWLVMMVPSWHQWNDQPDRDSIRWN
EQSGAIPTPNFIQHIQRQIANDRQVLLWRQNDPFYIPELPQYREWQLPDGQPTAHQHTIL
ARLLRANQGVWVIIAPRGRGKSTLAGMLIQQWQGHCWLTAPAKATTEVVRCYSSEKGQFW
AVDNLLKYCRQNSVSDIDWLLIDEAAAIPTPQLFELISYFPRILLTTTVQGYEGTGRGFL
HKFCAEIPGCHILNLTEPMRWAESDPLENWLEEALLFDDAVPANHSAKAIGYHVYQQQQW
IQQPELLKQFYGILTSAHYKTSPLDLRRLLDAKGMQFVAALGNNTLIGALWMVEEGGLSA
ELAHEIWAGRRRPRGNLVAQSLAAHSGLPQAAVLKSQRISRVAVQVNRRRQGIAQGMIAF
QRERAEEQGMDFISVSFGYTAELWALWQKCGFQLVRIGTHLEASSGCYTAMAIFPLSQQG
IALCVQAQQQLARDAYWLESQIGFSLPVDDQADQRLNQNDWQELAGFAFAHRPLSASLPA
LQRLLLNCGLPLTALRNHLQREMSIEQCVTELRLNGHKALTLLWRQETAQALVSLDEKLA
MYWQEWTTVFSEANRLHHPICH
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgttgccagaattaagtgcgatccaggcggaaatgcagcaacaaggattacgtcgtttg
ctagtgctgagtggagatcataattggtgtcaccaacaggctcatgagttacagcaggag
tttatgggtgattggttatggatctcttatcgcaaagagaaagctgttctacctgaaaaa
gcggcaggattattgggtcaggagtatttacacggagtatttgatgctaccgaaggtttg
aatgcggaagcactggcgatactagcgggtacgttgaaagcagggagctggttggtgatg
atggtgccatcatggcaccaatggaatgatcaaccagaccgtgacagtattcgctggaat
gaacaatcaggtgctataccaacgccgaattttattcagcatattcaacggcaaattgct
aatgatcgtcaggttttgctatggcggcaaaatgatcccttttatatccctgaattgccg
caatatagagagtggcaactacctgatggtcagccaacagcccatcagcatactattttg
gcgcgacttttgcgggcaaatcagggggtatgggtgattattgccccgagagggcgaggt
aaatcgacacttgctggtatgttgatacagcaatggcaaggacattgctggctaacggca
cccgcaaaagcaaccactgaagttgtcaggtgttattcaagtgaaaaaggacaattctgg
gcagtagataatttgttgaagtattgcagacaaaatagcgtatcagatattgattggttg
ctgatagacgaagccgctgctattccaacgccccagttatttgaacttatcagttatttt
ccccgaatattattaacaacaacagtacagggatatgaaggtaccggacgaggatttttg
cataaattttgtgctgaaattcctggctgtcatatattgaacctgacagaacctatgcgt
tgggcggaaagtgatccgctggaaaactggctggaagaagctttattgtttgacgatgct
gttcctgcaaatcattctgctaaagcgatcggctatcacgtatatcaacagcagcaatgg
attcagcaacctgagttactaaaacagttttatggaatattaaccagtgctcattataaa
acctcacctttagatttacggcgtttactggatgccaaaggaatgcaatttgttgcagct
cttggcaataacactttgattggtgctttatggatggttgaagagggcggattatccgct
gaactggcacatgaaatatgggcgggaagacgtcgcccaagaggaaatttggtagcgcaa
tcgttagcggcccacagtggtttaccccaagcggctgtcctgaaatctcagcgaattagc
cgggttgcggtgcaggttaaccgtcgaagacagggtattgctcagggaatgattgcgttt
caacgcgaaagagcagaagagcaaggaatggattttatttctgttagctttggttatacc
gctgaactttgggcgttatggcaaaagtgtggtttccaactggtacgaataggtacccat
ctggaagccagcagcggttgttataccgcaatggcaatttttccactcagtcaacaaggg
attgcactttgtgttcaggcacaacagcagcttgcccgtgatgcctattggttggagtca
cagattggattcagcttgcctgtcgatgaccaggctgaccaacgtctcaatcaaaatgac
tggcaggagcttgcaggttttgcatttgctcaccggccattgtctgcttcattgcccgct
ttacagcgattgttattgaattgtggtttgccgctgacagcgctaagaaatcaccttcag
cgggaaatgagtattgaacagtgtgtcactgagttaaggttgaatgggcataaggcatta
acgttactctggcggcaagaaaccgcgcaggcgctggtcagcctcgacgagaaacttgct
atgtactggcaggagtggactactgttttttctgaggccaatcgtcttcatcatcccatt
tgtcattaa

DBGET integrated database retrieval system