KEGG   Photorhabdus asymbiotica: PAU_01817Help
Entry
PAU_01817         CDS       T00941                                 

Gene name
dapE
Definition
(GenBank) n-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00300  Lysine biosynthesis
pay01100  Metabolic pathways
pay01120  Microbial metabolism in diverse environments
pay01230  Biosynthesis of amino acids
Module
pay_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PAU_01817 (dapE)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAU_01817 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18 Peptidase_M28 DEK_C
Motif
Other DBs
NCBI-ProteinID: CAQ83909
UniProt: C7BGY7
Position
complement(2047601..2048728)
Genome map
AA seq 375 aa AA seqDB search
MTCPVIELAQQLIRQPSVSPDDKGCQDIMISRLQAIGFTIERMPFGDTNNFWAYRGTGLT
LAFAGHTDVVPAGDESQWEHPPFEPTIRNGMLYGRGAADMKGSLAAMVVAAERFVTSHPN
HNGRLAFLITSDEEAQATNGTVKVVEALMSRNEQLDYCLIGEPSSQYRLGDMVKNGRRGS
LTANLTVHGIQGHVAYPHLADNPIHRAIPALQELVSTHWDQGNEFFPATSMQIANIHAGT
GSHNVIPGNLQVQFNFRFSTELTDSQIRERVETILKNHDLDYTIEWILPGEPFLTAKGEL
VDAVVQAIDHYCGYKPELSTSGGTSDGRFIARMGAQVVELGPINSTIHKVNEAVSAADLQ
QLSRIYQRVMEQLIQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtcctgtaattgaacttgcacaacaactcattaggcaaccatcagtcagtccg
gacgataaaggttgtcaagatattatgatctcccgcctgcaagcgatcggcttcaccatt
gaacggatgcctttcggcgatacaaacaatttttgggcttatcgtggtacaggtttaacg
ctggcctttgcaggacataccgatgttgttcctgcgggtgatgaatctcaatgggaacat
ccaccttttgagccgaccattcgtaatggcatgttatatggtcggggtgcagcggatatg
aaaggttcgctggccgccatggttgttgcagccgaacgctttgttaccagccaccctaat
cataatggccgcctagcttttcttattacctcagatgaagaagcgcaagccaccaatggt
accgttaaagtggttgaagcattgatgtcccgtaatgaacaactggattattgtctaatt
ggtgaaccctctagccaatatcgcctcggtgatatggtgaaaaatggccgtcgtggttcc
cttacagccaatttgactgtccatggcattcaaggccatgttgcctatccacatttagct
gataacccaattcaccgggctatccctgctttacaagaactagtcagtacacactgggat
caaggaaatgagtttttcccggcgaccagtatgcaaattgccaatattcatgccggaaca
ggcagccataacgtgatccctggaaatttacaggttcaatttaatttccgcttcagtaca
gaactaaccgatagccaaatccgtgaacgggttgaaaccatcctgaaaaaccacgacctg
gattacactattgagtggatattaccaggagagcctttcctgacagccaaaggcgaattg
gtcgatgccgtcgtacaagcaatagaccattactgtggctataagcctgaattatccacc
agcggtggtacatcagacggacggtttattgcccggatgggtgctcaagttgtcgaactg
ggcccaatcaactcaacaattcataaagttaatgaggctgtcagtgccgcagatctgcaa
caacttagccggatttatcagcgtgttatggagcagctaatccagtga

DBGET integrated database retrieval system