KEGG   Photorhabdus asymbiotica: PAU_01822Help
Entry
PAU_01822         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03832  periplasmic protein TonB
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01822
Transporters [BR:pay02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   PAU_01822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C TonB_2
Motif
Other DBs
NCBI-ProteinID: CAQ83914
UniProt: C7BGZ2
Position
2053975..2054775
Genome map
AA seq 266 aa AA seqDB search
MLTLTHPAFQTSHFKKGLVFAIAAHLIWAGWIIYQPKEISVNELMSPPAVMMELSLLTEA
IHQVQKQPIGIEQQLSVASRQQESAINEIKAPELIKDEQAQILVHKPKKQKKNHEEFKKT
PPVKRQQVEEQESEKSQSSAASVSSTATSANLTSRVAASYDSDSNAVVDADAAWRAEVIG
HLNRYKRYPEDAQRRNRTGRPTVRFTIDKQGYVTDSDLVRRSGTHSLDREAKQVLTRAQP
LPAPPDIILNGSEITIELPIDFSLIN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgacacaccctgcctttcaaacaagtcattttaaaaaaggactggttttc
gctattgctgctcatcttatttgggccggatggattatctaccagccaaaagaaatttct
gttaatgaattgatgtcacctccagcggtgatgatggagctttcattgctgacagaagca
atccatcaggtgcaaaaacaacctattggtattgaacaacaactttctgttgccagccga
cagcaagaaagtgcgattaatgagattaaggcacctgagcttattaaagatgaacaagca
cagattttggtacataagcctaaaaaacaaaaaaagaaccacgaagagtttaaaaaaaca
ccgccagtcaagcgccaacaggtagaagaacaagagagtgaaaaatcccaaagtagtgcc
gcttcagtgagtagtactgctacttctgccaatctgacttcgcgagttgctgcttcttat
gatagtgattcaaatgctgttgttgatgcagatgctgcatggagagcggaggttatcggg
catttaaatcgttataaacgttatcctgaggatgcgcagagaagaaaccgcactggccgg
cctacagtcagattcactattgataaacaaggctatgttactgacagcgacttagttcgc
cgctcaggtactcattctctggatagggaagcgaagcaagttctgacaagagcgcagcca
ttgccagctcctcccgatattattttaaatggcagtgaaattacgatagaacttccaatt
gattttagtttaatcaattaa

DBGET integrated database retrieval system