KEGG   Photorhabdus asymbiotica: PAU_01823Help
Entry
PAU_01823         CDS       T00941                                 

Gene name
ptrB
Definition
(GenBank) protease ii (oligopeptidase b)
  KO
K01354  oligopeptidase B [EC:3.4.21.83]
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pay01002]
    PAU_01823 (ptrB)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.83  oligopeptidase B
     PAU_01823 (ptrB)
Peptidases [BR:pay01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   PAU_01823 (ptrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9_N Peptidase_S9 Tannase Hydrolase_4 Abhydrolase_3 Abhydrolase_1 AXE1
Motif
Other DBs
NCBI-ProteinID: CAQ83915
UniProt: C7BGZ3
Position
2054906..2056963
Genome map
AA seq 685 aa AA seqDB search
MPPKAIKQPHQMTIHGDTRTDDYYWMRDDNRQDQKIIDHLIAENKYTEQMLKPGEQLRDT
LYQEMVDRMKQDDQSVPYTYNGYIYRTVYETGKDFPIYQRKPVDSSSDWQILVDGNERAK
GHEYYRLSNFAITPDNKRIAIAEDTQGRRNYQISFKEIGDEQWNNNVIKNASSNIVWAND
NNTLFYVRRHAQTLLPYQVFRHQYGTDTERDQKIYQEKDERFYLDLSRSSSCDYIMLSIT
STSTSEYLLIDANKPQAELQVFSPRQEGREYYIDHFRGHFYIRSNHENETYGLYQTDAIN
IPWKTVIAPQQDSDLEDFALFNNWLVVQERAKGLPTIRQINWETQQEKQIKFDDPSYMAW
IDYNPEPDTDFVRYGYSSMTTPSSTFQWDMRTGERELLKQQEVKGFDKHNYESLRIWVKA
RDGVEVPVSLVYRKSLFEKGHNPILIYGYGAYGASMDPAFSSPRLSLLDRGFVYALVHVR
GGGELGKQWYLQGKVENKMNSFNDFIDVTKALITQKYGDSKRVYAMGGSAGGLLMGAVIN
QAPELYRGVVAQVPFVDAVTTMLDPSIPLTVGEYEEWGNPENKEDYFRIKSYSPYDNIKP
QRYPNLLVTSGFHDSQVQYWEPAKWVAKLRDIKKGDTVLLLETNMSAGHGGKSGRFNRLK
DTALDYSFILMLDDAKKYFPQLKDN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggcaattaaacaaccacatcagatgactattcatggtgatactcgtaca
gatgattattattggatgagggatgataatcgccaggatcaaaaaattattgatcatttg
atagccgagaataaatatactgaacagatgctgaaacccggtgagcaattgcgggatacg
ttatatcaggaaatggttgatcggatgaaacaggatgatcaatctgtgccatatacttat
aacgggtatatttatcgtacagtctatgaaactgggaaagattttccgatttatcagcgt
aaaccggttgatagttcatcagattggcagattctggttgatggcaatgaaagggctaaa
ggacatgaatattatcggttgagtaattttgctatcactccggataataaacgtattgcg
attgctgaagatactcagggacgccgtaattatcagatctcttttaaagagatcggtgat
gaacagtggaataacaatgtaataaaaaatgcttccagcaacattgtttgggcaaatgat
aacaacacattgttttatgtgcgcagacatgctcaaactctgttgccataccaagtattt
cgtcaccaatatggtacagatactgagagggatcagaaaatatatcaggaaaaagatgag
cgattttacttagatctttctagaagttcttcctgtgattatattatgttgtcgataacc
agtacttcgacttcggaatatttattgattgatgcgaataaaccacaagctgaattgcaa
gtattttctccgcgtcaggaaggacgagaatattatattgaccatttccgcggtcatttc
tatatccgttcaaatcatgaaaatgagacttatggactttatcaaactgatgcaataaat
ataccttggaaaacagttattgctccacagcaggatagtgatcttgaagatttcgcattg
ttcaataactggttagtggtacaagagcgagcaaaaggattgccgacaattcgtcagatt
aattgggaaacacagcaagaaaagcagattaaatttgatgatccaagttatatggcatgg
attgattacaaccctgagcctgatactgattttgtacgttatggttattcatccatgact
acgccaagttcaacattccagtgggatatgagaacgggagaacgtgaattacttaagcaa
caggaagtaaaaggattcgataaacataattatgagagcctgcgtatttgggtgaaagct
cgcgatggcgtggaagttccagtatctctggtttatcgtaagtcactgttcgaaaaaggc
cataatccaatattgatatatggatatggggcttatggtgcgagtatggacccggcattc
agctcaccacgattgagtctgttggacagaggttttgtttacgcgttggtgcatgtgcgt
ggtggcggtgaattgggcaaacagtggtatctgcaaggtaaagtcgaaaataaaatgaat
agttttaatgactttatcgatgtaaccaaagctctgattacccagaaatatggtgacagc
aaacgtgtttatgctatgggaggtagcgctggtggcctgctgatgggcgcagtaattaat
caggcaccggaattatatcgtggtgttgttgctcaggtgccatttgttgatgctgttaca
accatgctcgatccctctattccgctgacagttggagaatatgaagagtggggtaatcct
gaaaataaggaagattatttccgaattaaatcatatagtccatatgataatataaagcct
cagcgctatcccaatttattggtcacgagtggatttcatgattcacaagttcaatattgg
gaaccggctaaatgggtggcgaaattgcgggatataaagaaaggtgacactgttttatta
ctggaaactaatatgagtgcaggacatggtggtaaatcaggccgttttaatcgtttgaaa
gatactgcattagattatagttttattttaatgttggatgatgctaaaaagtattttccg
caattaaaagataactga

DBGET integrated database retrieval system