KEGG   Photorhabdus asymbiotica: PAU_01828Help
Entry
PAU_01828         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SoPB_HTH
Motif
Other DBs
NCBI-ProteinID: CAQ83920
UniProt: C7BGZ8
Position
2064224..2064454
Genome map
AA seq 76 aa AA seqDB search
MCHEGKKCSLGIMLMTSDASKLDCSLWDTLQFMKEILKSHIPVIFQVSSLLAAFAHPGHI
VIYAPGDSLPCRRDAS
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
ttgtgccatgaagggaagaaatgtagtttagggataatgttgatgacaagcgatgcttca
aaacttgattgtagcttatgggatacgcttcaatttatgaaagagatactgaaaagtcat
atacccgtcatctttcaagtttcctctttgttggctgcattcgctcaccccggtcacata
gttatctatgctcccggggattcactcccttgccgtcgcgatgcatcttga

DBGET integrated database retrieval system