KEGG   Photorhabdus asymbiotica: PAU_01829Help
Entry
PAU_01829         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ83921
UniProt: C7BGZ9
Position
2064746..2065012
Genome map
AA seq 88 aa AA seqDB search
MSEQFTRWDSVEYLKTEADMAAYLDACIEEAGDDPAFIARALGTIARARGMTQVAKLNYP
FCYLYPSSFKLLLCWLLSLAAALQLEIN
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagtttacccgttgggattcagtagaatacctgaaaactgaagctgatatg
gcagcgtatctggatgcctgtattgaagaagctggtgatgatcctgcttttattgcgcgt
gcgctaggtacgatcgcgcgtgcgcgtggtatgacccaggtagcaaaattgaattatccc
ttctgctatctatatccttcatccttcaagttgctgctttgttggttgctttcacttgct
gccgctctgcaactcgaaatcaattag

DBGET integrated database retrieval system