KEGG   Photorhabdus asymbiotica: PAU_01831Help
Entry
PAU_01831         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ83923
UniProt: C7BH01
Position
complement(2065473..2065664)
Genome map
AA seq 63 aa AA seqDB search
MPNTNYFDLIPSKSDIDTLSDDLDKVRADFAIVLKQFNDEIISSTGKETIYDQKNKQKTS
ENN
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacgaattattttgatcttattccatcgaagagtgatattgatactttatca
gatgacctggataaagttcgggcagactttgctattgtattaaagcaattcaatgatgaa
atcatatcatctacagggaaagagacgatatatgatcaaaagaataaacagaaaacatcc
gaaaataactaa

DBGET integrated database retrieval system