KEGG   Photorhabdus asymbiotica: PAU_01834Help
Entry
PAU_01834         CDS       T00941                                 

Gene name
yobD
Definition
(GenBank) upf0266 inner membrane protein plu2700
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF986 PAP2_3
Motif
Other DBs
NCBI-ProteinID: CAQ83926
UniProt: C7BH04
Position
complement(2067942..2068400)
Genome map
AA seq 152 aa AA seqDB search
MSLNDMVLVGLIVLMLILAIYDEFVVNLLKGKTYLQIKLKRKHRIDAFIFIILILIVVYN
NITAYGSRLTTYLLLFTILVTLYIAYIRSPKLLFKSNGFFYANTFISYDRIKTINLSEDG
ILVIGLENKKLYISVYQLDDLERIYKFLIENR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcaatgatatggtattagttggattaatcgtactaatgctgattctcgctatc
tatgatgaatttgtggttaatctgctgaaagggaaaacttatttgcaaataaagttaaaa
agaaaacatagaattgatgctttcatctttattatcctgatacttattgttgtttataac
aacatcactgcttatggtagtcgtttaaccacatacttattgttatttactatcctggta
actctttatattgcctatatacgctcacctaaattgttatttaagagcaatggttttttc
tatgcaaatacgtttatttcttatgaccggataaaaaccataaatttatctgaagatggc
attctggttattggtttggaaaataagaaattatatatctcagtctatcaacttgatgat
ttagaaaggatttataaattcctcatcgaaaacagatag

DBGET integrated database retrieval system