KEGG   Photorhabdus asymbiotica: PAU_01843Help
Entry
PAU_01843         CDS       T00941                                 

Gene name
yebF
Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YebF
Motif
Other DBs
NCBI-ProteinID: CAQ83935
UniProt: C7BH13
Position
2075721..2076095
Genome map
AA seq 124 aa AA seqDB search
MKACHVINRVGLSGAALLFTISFTVSAVPETKRVDKFVSCDNLTKSQIAAQVKRDFLQNR
INRWSEDRKQLGTSTPVAWINVENITADKDVLEVPLTVRGSKHDKDYRVVVNCQQNTISY
SELK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatgtcatgtcattaatagagttggcctatcaggtgctgcacttttatttacg
atttcattcaccgtatccgctgttccagagaccaaacgtgttgataaatttgtttcttgc
gataatttaaccaaatcgcagattgctgctcaggtaaagcgagattttctacaaaaccgt
attaatcgttggtcagaagatagaaaacagttgggaacttctacaccagtggcgtggata
aatgtagaaaatatcaccgcagataaggatgtgttagaagttccactgactgttcgtggt
tctaagcatgacaaagattaccgtgttgtagttaattgtcagcaaaatacgattagctat
agcgaattgaaataa

DBGET integrated database retrieval system