KEGG   Photorhabdus asymbiotica: PAU_01846Help
Entry
PAU_01846         CDS       T00941                                 

Definition
(GenBank) hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pardaxin
Motif
Other DBs
NCBI-ProteinID: CAQ83938
UniProt: C7BH16
Position
complement(2077447..2077572)
Genome map
AA seq 41 aa AA seqDB search
MKMNFIRKIISSNIFLYLMIMNIIYIYKFINLVLARKISLD
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaattttattcgcaaaataatctcatcgaatatctttctatatttaatgata
atgaatattatttatatttataaatttatcaatttagttcttgccagaaaaatcagtctg
gattaa

DBGET integrated database retrieval system