KEGG   Photorhabdus asymbiotica: PAU_01854Help
Entry
PAU_01854         CDS       T00941                                 

Gene name
prc
Definition
(GenBank) carboxy-terminal protease for penicillin-binding protein 3
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     PAU_01854 (prc)
Peptidases [BR:pay01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   PAU_01854 (prc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 DUF3340 PDZ PDZ_2
Motif
Other DBs
NCBI-ProteinID: CAQ83946
UniProt: C7BH24
Position
2082649..2084700
Genome map
AA seq 683 aa AA seqDB search
MNKFVRLAFVLGVSIFGTCYANTNSPAAVPVRIEQLPILKQEPQHSTVSERVTSRFIRSH
YRQFSLDGDFSVKIFDRYLNILDYSHNILLASDVAEYADKKKLLGQELESGNLEIPYDLF
NLLQKRRFERYQYALSRLERPMNFDDNDTIDVDRSKAPWPQSVEELNRLWDAKVKYDWLN
LKLAGKDDKEIKEVLTKRYQFALKRLTQSQSEDVFQLIMTAFAREIDPHTNYLSPRNTEQ
FNSEMSLSLEGIGAVLQIDDDYTVINSMVAGGPAAKSKALKVGDKIIGVGQSGKSMVDII
GWRLDDVVALIKGPKGSKVRLEVISDTKGAKPRTITLTREQIRLEDRAVKMSVKTIGKEK
VGVLDIPGFYVGLTDNVKTQLQKLTKQHVSAIVIDLRSNGGGALTEAVSLSGLFLPSGPI
VQVRDNNGKIRQDSDTDEVVYYKGPLVVLVDRFSASASEIFAAAMQDYGRALIVGEPTFG
KGTVQQYRSLSRIYDQMMRPDWPSLGSVQYTIQKFYRVNGGSTQRKGVTPDIVMPTGVDP
AETGESFEDNALPWDSIPPARYTGSKVIAALVPQLNVAHNARIADDPEFKYINEDIAHYK
AMKERKNIVSLNYVQREKENKEDEVLKLNRINDRFKREGKKPLASLDDLPKDYQGPDPYL
DESAKIALDLAHQPAEKMLAQSK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcgtcagactggcttttgtcttaggcgtttcaatttttggtacttgttat
gcaaatacaaacagtccagcagcggttcctgttcgtattgaacagctgcctatattgaag
caagaacctcagcattccactgtgagcgagcgggtaacatcccgcttcattcgttcccat
taccgtcaatttagtttagatggtgatttttcagtaaaaatatttgaccgttatctcaat
atattggactacagccataatatattgttggcgtcagatgtagctgagtatgcggataag
aaaaaattgttaggtcaggaattggaaagtgggaatctggaaatcccatatgacctgttt
aatctattacagaaacgccgttttgagcgttatcagtatgctttatctcggcttgagcgg
ccaatgaattttgatgacaacgatacaattgatgttgatcggtctaaagccccttggcca
cagagtgtagaagaactgaataggctttgggatgctaaagttaaatatgattggcttaat
ctcaagctcgcaggtaaagatgataaagaaattaaagaagtgctgactaagcgctatcag
tttgcgttaaagcgtctgacacaaagtcagagtgaagatgttttccaactgattatgact
gcgtttgctcgtgagattgatcctcataccaattacctttcaccacgcaatactgaacag
tttaactcagagatgagcctgtcccttgaaggtattggtgctgttttacagatagacgat
gactacactgtcataaattctatggttgctggtggtcctgctgctaaaagtaaagcgcta
aaagtgggagataagattatcggtgtcggtcaatcagggaagtcaatggttgatattatt
ggctggcgtttggatgatgtggttgcactgattaaaggccctaaaggtagtaaagtgcgg
cttgaggttatttctgatactaaaggggcgaaaccacgtactatcactttaactcgtgaa
cagatccgtctggaagaccgggcagtgaagatgtcagtgaagacaatcggtaaagaaaaa
gtaggggtgcttgatatcccgggtttttatgtcggcttaactgataatgttaaaactcaa
ttgcaaaaactgactaagcagcatgttagtgctattgtcatagatctgcgtagcaatggt
ggtggtgcactgacagaggcggtttctttgtctggcctgtttcttccaagtggcccgata
gtgcaagtcagggataataacgggaaaattcgtcaggactctgatactgatgaagtggtg
tactataaaggacctttggttgtgctggtagatcgtttcagtgcttctgcttctgagatt
tttgccgcagctatgcaggattatgggcgagctttgattgttggagagccaactttcggt
aaagggactgttcagcaatatcgttctttgagtcgtatttacgatcaaatgatgcgccct
gattggccatcgttgggttctgtccagtatacaattcagaaattctatcgtgtaaatggt
ggtagtactcagcgtaaaggtgtgacacctgatattgtaatgccaactggagttgatccg
gcagaaacaggcgagagttttgaagataatgctttgccttgggatagtattcctcccgcc
cgttatacggggtctaaagttattgccgcgttagttccgcagttaaatgtggctcataat
gcccgtattgcagatgatccagaatttaagtatatcaatgaggatattgctcactataag
gcgatgaaagagcgtaaaaatatcgtttctttgaactatgtacaaagagagaaagagaat
aaagaagacgaggttctgaaattgaaccggattaatgatcgctttaaacgagaaggtaaa
aaaccattagcttcattggatgatttacctaaggattatcaaggacctgatccttatctt
gatgaatcagcgaagattgcgcttgatttagcacatcagcctgctgagaaaatgttagct
caatctaagtag

DBGET integrated database retrieval system