KEGG   Photorhabdus asymbiotica: PAU_01855Help
Entry
PAU_01855         CDS       T00941                                 

Gene name
htpX
Definition
(GenBank) probable protease HTPX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
pay  Photorhabdus asymbiotica
Module
pay_M00743  Aminoglycoside resistance, protease HtpX
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pay01002]
    PAU_01855 (htpX)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     PAU_01855 (htpX)
Peptidases [BR:pay01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   PAU_01855 (htpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M56 Peptidase_M1 SprT-like
Motif
Other DBs
NCBI-ProteinID: CAQ83947
UniProt: C7BH25
Position
2085035..2085922
Genome map
AA seq 295 aa AA seqDB search
MMRIALFLLTNLAVMLVFGIILSLTGIQGSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR
SVGGQVIEQPTNEIEHWLVETVRRQAEQVNIAMPQVAIYAAPDINAFATGARRNASLVAV
STGLLDNMSRAEAEAVIAHEISHIANGDMVTMTLLQGIVNTFVIFISRLLAQAVSSFLSG
NNENEEESNSGNPIVYMVVSMVLEIVFGILASIITMWFSRYREFHADAGSAKLVGREKMI
AALQRLKTSYEPQEEGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRNGQYLNK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaattgctttgttcctcctcaccaaccttgctgttatgttggtgtttgggata
atactgtctctgacaggaattcagggaagtagtgtacagggtctaatgattatggctggt
ctgttcggttttggtggagcgtttgtttctctgctgatgtccaaatggatggctctgcgt
tctgttggtggtcaggttatagaacagccaacaaatgaaattgaacattggttagtagaa
actgttcgccgtcaggcagaacaagtcaatattgctatgccacaggttgcgatttatgct
gcgcctgatattaacgcattcgctaccggagcgcgccgtaatgcatctctggtagctgtc
agtactggcctattggacaatatgagtcgagcagaagcggaagctgttatcgctcatgag
attagccatattgctaatggtgatatggtgaccatgactttgttgcaagggatagtaaat
acttttgttatctttatttcccgtttgttggctcaggctgtatcaagttttctgtctggt
aacaatgaaaatgaagaagaaagcaattctggtaatccgattgtttacatggtcgtttcg
atggtgttggaaatagtattcggtattctggcaagtattattactatgtggttctcccgt
taccgtgaattccacgcagatgcaggttctgccaagttggtgggccgtgagaagatgatt
gctgctttacaacgtctgaaaaccagttatgaaccgcaagaagaaggcagtatgatggcg
ttctgtattaatgggaaatctaagacattcagtgagctttttatgtctcacccaccatta
gacaaacgtattgaagcactgcgtaatgggcaatacctgaataaataa

DBGET integrated database retrieval system