KEGG   Photorhabdus asymbiotica: PAU_01863Help
Entry
PAU_01863         CDS       T00941                                 

Definition
(GenBank) iron transport system atp-binding protein yfeb
  KO
K11607  manganese/iron transport system ATP-binding protein
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02010  ABC transporters
Module
pay_M00317  Manganese/iron transport system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAU_01863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01863
Transporters [BR:pay02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter [MD:M00317] [OT]
    PAU_01863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N SbcCD_C Mg_chelatase MMR_HSR1 AAA_15 AAA_16 AAA_22 AAA_23
Motif
Other DBs
NCBI-ProteinID: CAQ83955
UniProt: C7BH33
Position
complement(2093123..2094019)
Genome map
AA seq 298 aa AA seqDB search
MNSSKPFERPHLVVDDATVTYNNGHTAIYDASFSITGGTICALVGINGSGKSTLFKTIMG
LVNPSQGKVTLSNMPVKSALKKNIIAYVPQTEEVDWNFPVLVSDVVMMGRYGKMGFLRIP
GKKDHQTVDEALERVGLTALRNRQIGELSGGQKKRVFLARALAQEGKVLLLDEPFTGVDV
KTENAIIDLLCDLRDEGHLVLVSTHNLGSVPEFCDHVILINRTVLASGPTETTFTQKNLE
RTFGGVLRHINLSGSELHDDDDPRSLTVITDDERAAVFYGHNHHIPPRQTQQKEKRQP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcagtaagccgtttgaacgtcctcatttagtggttgatgatgccactgtaact
tacaacaacggtcacaccgctatttatgatgcaagtttctccatcactggcggtactatc
tgtgcgttagttggtattaacggtagcggtaagtccacattgtttaagactattatgggt
ctggtaaacccatctcaagggaaagttaccctgagcaatatgcctgttaaaagcgcttta
aagaaaaatatcattgcatatgtaccgcagacagaagaagttgactggaactttccagta
ctggtttccgatgttgttatgatgggccgctacggcaaaatgggatttttgagaatccca
ggtaaaaaagatcaccaaactgttgatgaagctcttgaacgcgttggcttaactgcccta
cgcaatcggcagattggtgaactttcaggcggacagaaaaaacgggtttttcttgcaagg
gctctggctcaagaaggaaaagttctattactggatgaacctttcaccggtgttgacgta
aaaacagaaaatgccatcatcgacttactgtgtgatttacgcgatgaaggccatctggtg
ctggtttcaacacacaatctcggtagtgtgcctgaattctgtgaccatgttatcctgatc
aaccggactgttctggccagtggcccaacagaaacaacattcactcaaaagaatttagag
aggacttttggtggagtgcttcgccacatcaatctatctggatcagaattacatgatgac
gatgacccacgttctctaactgttattactgatgatgaacgtgcagcagtcttttatggt
cataaccatcatattccgccgcggcaaactcagcaaaaggagaaacgccaaccatga

DBGET integrated database retrieval system