KEGG   Photorhabdus asymbiotica: PAU_01864Help
Entry
PAU_01864         CDS       T00941                                 

Definition
(GenBank) iron (chelated) abc transporter, periplasmic-binding protein yfea
  KO
K11604  manganese/iron transport system substrate-binding protein
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02010  ABC transporters
Module
pay_M00317  Manganese/iron transport system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAU_01864
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01864
Transporters [BR:pay02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter [MD:M00317] [OT]
    PAU_01864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA TPR_17
Motif
Other DBs
NCBI-ProteinID: CAQ83956
UniProt: C7BH34
Position
complement(2094016..2094930)
Genome map
AA seq 304 aa AA seqDB search
MKKKLSLLPSPILGMTLILLSIVLFSQQVSATKKFKVVTTFTIIQDIAQNVAGDAAIVES
ITKPGAEIHDYQPTPKDIIKSQHADLILWNGLNLERWFERFFENLKDIPAVVITDGILPL
PIREGPYNGNPNPHAWMSPTNALVYIENIRKAFVKYDPENAESYNRNAKAYAEKIAKLDS
PLRERLSRIPQDQRWLVTSEGAFSYLAKDYQLKEVYLWPINAEEQGSPQQVRHVIDTVRA
NKIPVVFSESTISDKPAKQVSKETDARYGGVLYVDSLSGSDGPVPTYIDLLNKTVDTIAK
GFNQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaactttctctgctcccttctcccatactgggaatgactttgattctccta
tctatagttttattcagccagcaagtatctgccactaaaaaattcaaagtcgtcaccacc
tttactatcattcaggatatagcacaaaatgtagcaggtgatgctgcaattgttgaatca
attactaaaccaggcgctgaaatccatgattatcaacctacccccaaagatattattaag
tcccaacatgctgatttgattctatggaatggattgaatttggaacgctggtttgagcgc
ttctttgaaaatctcaaagatataccagcagttgttattactgacggcattctaccatta
cctatccgtgaaggaccttataacggaaatcctaaccctcacgcatggatgtcgccaaca
aacgccttggtctatattgaaaatattcgcaaagcatttgtgaaatatgatcctgaaaat
gcagaaagttataataggaacgccaaagcctacgctgaaaaaatcgcaaaactcgattct
ccattgagagagcgtctttcccgtattccacaggatcaacgttggctagttaccagtgaa
ggtgctttcagttatctggctaaggattatcaactcaaagaagtttatctgtggccaatc
aatgcagaagaacaaggctcgccacaacaagttcgtcatgtcattgatactgtaagagca
aataaaatcccagttgtatttagcgaaagtacaatttctgataaaccagccaaacaagtc
agtaaagaaactgatgcccgttatggtggtgttctttatgtagactcactctctggtagt
gacggtccagtaccaacgtatattgatttgttgaacaaaaccgtagatacaatagcaaaa
ggatttaatcaatga

DBGET integrated database retrieval system