KEGG   Photorhabdus asymbiotica: PAU_01973Help
Entry
PAU_01973         CDS       T00941                                 

Gene name
yeaD
Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_01973 (yeaD)
Enzymes [BR:pay01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PAU_01973 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAQ84065
UniProt: C7BIC7
Position
complement(2209669..2210547)
Genome map
AA seq 292 aa AA seqDB search
MNDKIFALPVAKQISPSISQRNMDELPLIVISHPKVRGAISLQGAHLIAWQPRGQEPGLW
LSKKAVFKAGSAIRGGIPICWPWFGSIGTPSHGFARILPWEFSAHNEHENGVILTFTLRD
NEYTHKLWPHDFTLIARFKLCETCEVELETYGNYQATGALHTYLNVGDVNQISVSGLGKH
FIDVITGKEQHTVEEYLIFNDRTDRVYTEPEDFSLIRDKLLKRTIEIYHYHHSDVVCWNP
GAALSDNMKDICDKGYKNMICVETARINKPLIAKDDNPAHISVTIRCRKDNW
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaaatttttgcattaccggttgcgaaacagatatccccttctatcagtcag
cgaaacatggatgaacttccattgattgtcatatctcatccaaaagttcgtggggcaatc
agcctgcaaggggcacatctcatcgcctggcaacccagaggtcaggaaccgggattatgg
ctaagcaagaaagcagtatttaaagcaggctcagctatccgcggtgggattcctatttgc
tggccctggtttggctcaataggaacaccaagtcacggttttgccagaattctaccctgg
gagtttagcgcacataatgaacatgaaaatggagtaatattaactttcactctgagagat
aatgaatatacccataaattatggccgcatgattttaccctaattgcacgtttcaaactg
tgtgaaacctgtgaagtagagctggaaacttatggtaattatcaagcaaccggtgcactg
catacgtatctgaatgtaggcgatgttaatcaaatttctgtcagcggcttgggtaaacat
tttattgatgttattactggtaaagagcaacacacagtagaagaatatcttattttcaat
gatcgtactgaccgcgtttatacagaaccagaagattttagtctgataagggataaatta
ctgaaacgaacgattgaaatttaccattatcatcacagtgatgttgtatgctggaaccca
ggggctgctctatcggataatatgaaagatatatgcgataaaggttataagaatatgatt
tgtgtagaaaccgctcgtataaataaaccattaattgccaaagatgataatccagcccac
atttcggttacaatccgctgccgaaaagacaattggtaa

DBGET integrated database retrieval system