KEGG   Photorhabdus asymbiotica: PAU_02063Help
Entry
PAU_02063         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAU_02063
Enzymes [BR:pay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     PAU_02063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: CAQ84155
UniProt: C7BJ87
Position
2318276..2319028
Genome map
AA seq 250 aa AA seqDB search
MGVNVLAVTDHDTTDAIPLAHEYISQHNLPLKLISGVEISTLWQNIEIHIVGLNIDIQSD
AMIELLNRQSELRKERGIEIGRRLAKVGIPDTWAGASQLANGGQVTRGHFARYLIEIGRE
PTIAKVFKKYLAKGKIGYVPPQWCTIEQAIDAIHQSGGQAVIAHPGRYNLSTKWLKRLIV
WFKQHGGDAMEVAQCQQAPNERQYLGQLSREYDLMASLGSDFHQPCAWIELGRKLWLPGD
VVPIWRNWSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttaatgtattggctgtgactgatcatgatacgacggacgctattccgttagct
catgaatatatcagccaacacaatttgccattgaaactcatatcaggcgttgagatatca
actctgtggcaaaatatagagattcacattgtggggttgaatattgatattcagtcagat
gcaatgattgaattacttaatagacaatctgaactcagaaaggaacgaggcattgaaata
ggccgcagattggcaaaggtaggtattcccgatacttgggcaggggcaagccaattagcg
aatggtggacaagtgacacggggccattttgcccgctatttaatcgaaattggtagagag
ccaacgattgcgaaagtatttaagaaatatctggcaaagggaaaaatcggatacgttcca
ccgcaatggtgtacaattgaacaagctattgatgccattcatcaatcaggcgggcaggca
gtcattgcgcatccggggcggtataatttatctactaagtggttgaaacgtttgattgtc
tggtttaagcaacatggtggtgatgcgatggaagttgcacagtgccagcaggcacctaac
gagcggcaatatctcggtcaattgtcacgggaatatgatttgatggcttcgttaggttct
gattttcaccagccttgtgcatggatagagttagggcgtaaattgtggttacccggtgat
gtggtaccaatatggcgcaactggtcactgtag

DBGET integrated database retrieval system