KEGG   Photorhabdus asymbiotica: PAU_02282Help
Entry
PAU_02282         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_02282
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_02282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: CAQ84374
UniProt: B6VKX1
Position
complement(2586538..2587089)
Genome map
AA seq 183 aa AA seqDB search
MNTQRKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFAEQSIPMRERRFMHVDKD
NFNAVMEGLSPSLELQVESALPDQSGFINIDLQFQSMADFSPENLAKQIEPLRNLLEIRS
KLSDLKGRALSNEKLRDRLAEILAEHADKLPPVNEEAETVATENTTDDVTPENNNIPEDN
NAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaacgtaagcttgataaagtaaggccgccccgtgttcagattacttatgat
gtcgaattaggtggtgcggttgagaaaaaagaattgcctttggttattggtgtgattggg
caatttgctgagcaatcaattcctatgcgtgaacgtcgttttatgcatgttgataaagat
aattttaatgctgttatggaaggtttatcaccttctttggaattacaggttgaaagtgct
ctgccggatcagagtggatttattaatatcgatttgcaatttcaatcaatggctgatttt
tccccggagaatttggcgaagcagattgagccacttcgtaatttattggaaattcgcagc
aaattaagtgatttgaaaggtcgtgcattgagtaatgaaaaattgcgtgaccgtctggcg
gaaattcttgctgaacatgcggacaaattaccgccggtaaacgaggaagcagaaaccgtt
gcaacagaaaatacaacggatgacgttaccccggaaaataacaatattccggaagataac
aatgcacagtga

DBGET integrated database retrieval system