KEGG   Photorhabdus asymbiotica: PAU_02414
Entry
PAU_02414         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_02414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_02414
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_02414
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAQ84506
UniProt: B6VL63
Position
2760185..2760670
AA seq 161 aa
MAIPLYMYIKDDGGSDIKGSVDVYGREGSIEVLGLHHSVSIANDDNTGKLTGTRKHLPFM
IEKEIDSSSPYLYKALTTGQTLKSAELKWYKINEHGQEKEYFNTFMENVKVVNIVPVMFD
IKYASKEKFNHMEIVELRYEKIIWKYNTGNIIHSDSWNERV
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctattcctctctatatgtacataaaagacgatggcggatcagatattaaaggttct
gttgatgtctatggtagagaaggcagtattgaggttttgggtcttcatcatagtgtcagt
atcgccaatgatgataatacgggaaaattgactggaacgaggaaacatctcccatttatg
attgaaaaagaaattgactcgtcatcaccctatctttataaggcactaaccacagggcaa
acattaaaatcagcagagttaaaatggtataaaataaatgaacatggacaagaaaaagag
tatttcaatactttcatggaaaatgtaaaagtggttaatattgttcctgttatgttcgat
ataaagtatgcatcaaaagaaaaattcaatcatatggaaatcgttgaacttcgctacgaa
aaaatcatctggaagtataatactggaaatataattcattctgatagctggaatgagaga
gtttaa

DBGET integrated database retrieval system