KEGG   Photorhabdus asymbiotica: PAU_02433Help
Entry
PAU_02433         CDS       T00941                                 

Gene name
fadD
Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00061  Fatty acid biosynthesis
pay00071  Fatty acid degradation
pay01100  Metabolic pathways
pay01212  Fatty acid metabolism
pay02024  Quorum sensing
Module
pay_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAU_02433 (fadD)
   00071 Fatty acid degradation
    PAU_02433 (fadD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAU_02433 (fadD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pay01004]
    PAU_02433 (fadD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_02433 (fadD)
Enzymes [BR:pay01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PAU_02433 (fadD)
Lipid biosynthesis proteins [BR:pay01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PAU_02433 (fadD)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PAU_02433 (fadD)
  Exosomal proteins of breast cancer cells
   PAU_02433 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: CAQ84525
UniProt: B6VL43
Position
complement(2778321..2780009)
Genome map
AA seq 562 aa AA seqDB search
MEKVWLKHYPADIPVEIDPDRYASLVEMFENAVAHYADQPAYINMGEVMTFRKLEERSRA
FAAYLQNGLGLSKGDRIALMMPNLLQYPVALFGSLRAGLVVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKIVFNTRVKHVILTRMGDQLSRPKGTLVDFAVKYIKRLVPKYHL
PDAISFRCAIHKGYRMQYVKPDINGDDLAFLQYTGGTTGVAKGAMLSHRNMLANLEQAKA
VYSPLLRVGQELIVTALPLYHIFALMVNCLLLIYVGGCNLLITNPRDITGTAKELSRYQF
TSVTGVNTLFNAWLNNEEFKKLDFSALRLVVGGGMPVQKTVAEKWAKVTGRTLLEGYGLT
ECSPLVSCNPYNVKNYTGSIGFPVSSTDIKLTDDDGNEVPIGQQGELWVRGPQVMVGYWN
RPDATDEVLKDGWVATGDIANINEQGFIHIVDRKKDMILVSGFNVYPNEVEDVVSAHPKV
LESAAIGVPSESSGETVKVFVVRIDSSLTEDELKTHCRRYLTGYKVPKIIEFRDELPKSN
VGKILRRELRGEEEKVRNAVVA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
ttggagaaagtctggctaaaacattatccggcagatatccctgtggaaattgacccggat
cgttatgcatcattggttgaaatgtttgaaaatgccgtagcgcactatgcagatcaacct
gcgtatataaatatgggtgaggttatgaccttccgtaagttggaggagcgtagccgggcg
tttgctgcttatttgcaaaatggtttgggattaagcaaaggggatcgtattgcattgatg
atgccaaacttgttgcaataccctgttgctttgtttggttctttgcgcgcaggtttggtt
gtcgtaaacgtaaatcctttgtatacgccacgcgaacttgaacatcagcttaatgacagc
ggcgcttcagccattgtgatcgtttctaactttgctcatacgctggagaagatcgttttt
aataccagagttaagcatgttattttgacgcgtatgggtgatcagttatctcgtcctaaa
ggtacattggttgattttgctgtgaaatatatcaaacggttggtaccgaaatatcacctg
cctgatgctatttcatttcgttgtgcgatacataaaggttatcgcatgcaatatgtgaaa
ccggatattaacggtgatgatttggccttcctgcaatatactggtggcactaccggcgtc
gctaaaggggcgatgctgagtcatcgtaatatgctagcaaatcttgagcaggcaaaagcg
gtttattcgccattactgcgggtgggtcaggaactaatagttactgcgctaccgctttat
catatatttgcgttaatggtgaactgtttgctacttatttacgtgggtggatgtaatctt
ctgatcactaatccgcgtgatattacagggacagctaaggaattgagtcgttatcagttc
acttcagtgactggtgtgaatacgttgtttaacgcttggttaaataatgaagaatttaag
aagcttgatttttccgcattgcgtcttgttgttggtggtggtatgccagttcagaaaaca
gttgctgagaagtgggctaaagtgacgggaaggactcttcttgagggatatggtttgaca
gagtgctcaccattggtttcctgtaatccttataacgtgaaaaattacactggtagtata
ggctttccagtgtcttcaacggacatcaaacttaccgatgatgatggtaatgaggtacca
ataggccagcagggagaactgtgggtccgcggcccacaggttatggtgggttattggaat
cgccctgatgcgacagacgaagtattgaaagatggctgggtagcaacgggtgatattgcg
aatatcaatgaacaaggttttattcatatcgtagatcgtaagaaagatatgattttggtt
tctggtttcaatgtgtatcctaatgaagttgaagatgttgtatcagctcacccgaaagtg
ctagagtcagcagcaataggtgtaccaagtgaaagctccggtgaaaccgttaaagtattt
gtggttcggatagattccagtttgaccgaggatgaacttaaaacgcattgtcgtcgttat
ctgacaggttataaggtacctaaaatcattgagttccgggatgaattacctaaatctaat
gtaggtaaaattcttcgaagggaactgcgaggtgaagaggaaaaagtaaggaatgcagtt
gtagcctga

DBGET integrated database retrieval system