KEGG   Photorhabdus asymbiotica: PAU_02443Help
Entry
PAU_02443         CDS       T00941                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00030  Pentose phosphate pathway
pay00480  Glutathione metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
Module
pay_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pay_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAU_02443 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAU_02443 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_02443 (zwf)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PAU_02443 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PAU_02443 (zwf)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PAU_02443 (zwf)
  Exosomal proteins of colorectal cancer cells
   PAU_02443 (zwf)
  Exosomal proteins of bladder cancer cells
   PAU_02443 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CAQ84535
UniProt: B6VL33
Position
complement(2788500..2789975)
Genome map
AA seq 491 aa AA seqDB search
MAVTSTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGYIHPETRIIGVGRADWDKKAYTK
VVEEALNTFLSEELDPELWKTLSERLAFCNLDVNQKEDFAKLKAILKRENRPAIHYFAMP
PSTFGSVCHGLGLAGLNKEPNRVVMEKPLGIDLESSKAINDEVAKYFNECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDHRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILTMIAMSPPADLTTDHIRDEKVKVLRSLRRIDHTNVREKTVRGQYTAGFVQGSKVPG
YLEEEGANQSSRTETFVSIRVDIDDWRWAGVPFYLRTGKRLPTKCSEVVVYFKKPALNLF
SESYQQLPQNKLTIRLQPDEGIDIEVLNKAPGLEHKHRLQTTKLDLSFSETFNHIPLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMNAWAADNEAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggttacttccacggctcaggcttgtgatttagtaatttttggtgctaaaggggat
ttggctcgccggaaattattaccttccctttatcagcttgagaaagcgggttatatccat
cctgaaacccgaattattggtgtcggtcgggctgattgggataaaaaggcttataccaaa
gtggttgaagaagctttaaataccttcttatcggaagaattagatccagagttatggaaa
acactgagtgaacgtttggcgttttgcaatctggatgttaatcaaaaggaagactttgcc
aaactgaaagcaattcttaagcgggagaatcggcctgcaattcactattttgcgatgcca
ccaagtacttttggctcagtttgtcatggattgggccttgcaggactaaataaagagcca
aaccgggttgtgatggaaaagcctttagggatcgatcttgaatcatctaaagccattaat
gatgaagtggcaaaatatttcaatgagtgtcaggtttatcgtatcgatcattatctgggt
aaagaaacggtattgaatttgttggcgttgcggtttgccaattctttgttcgtgaataac
tgggatcaccggacaattgatcatgtacaaattacggtagcggaagaagtcggtattgaa
ggccgttggggttattttgatcaggccgggcagatgcgcgatatgattcagaatcacttg
ttacaaatattgactatgattgcgatgtctcctccggcagatttaacaacagaccatatc
cgtgatgaaaaagtgaaagtattgcgttctctgcgccgtattgatcacacaaatgtacgg
gagaaaacggtgcgcggtcagtacaccgctggttttgttcagggcagtaaggtaccgggt
tatctggaagaagagggagctaaccagtctagtagaacagaaacttttgtctctatccgt
gtcgatattgatgactggcgttgggctggggttcctttttatttgagaaccggtaagcgc
ctgccaactaaatgttctgaggtggtggtttatttcaagaaaccggcactgaatttgttc
tctgaatcttatcaacagttaccgcagaacaaactgactattcgtctgcaaccggatgaa
ggtattgatattgaagtgctgaacaaagcaccggggcttgagcataaacaccgtttgcaa
acaactaagttggatttgagtttctctgaaacttttaatcatattccgctagcggatgct
tatgagaggttattactggaagcgatgcgtggtattcaggcgctattcgttcgtcgtgat
gaagtggaagaagcctggaagtgggtcgattctattatgaatgcatgggcggcggataat
gaagcgcctaagccttatcaggcgggaacgtggggacccgttgcttctgttgctatgatc
acccgtgatggccgttcgtggaatgaattcgaataa

DBGET integrated database retrieval system