KEGG   Photorhabdus asymbiotica: PAU_02514Help
Entry
PAU_02514         CDS       T00941                                 

Gene name
luxC
Definition
(GenBank) acyl-CoA reductase
  KO
K03400  long-chain-fatty-acyl-CoA reductase [EC:1.2.1.50]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay02020  Two-component system
pay02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAU_02514 (luxC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAU_02514 (luxC)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.50  long-chain acyl-protein thioester reductase
     PAU_02514 (luxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxC Aldedh
Motif
Other DBs
NCBI-ProteinID: CAQ84606
UniProt: C7BN07
Position
complement(2869292..2870734)
Genome map
AA seq 480 aa AA seqDB search
MNKKISFIINGRVEIFPESDDLVQSINFGDNSVHLPVLNDSQVKNIIDYNENNELQLHNI
INFLYTVGQRWKNEEYSRRRTYIRDLKRYMGYSEEMAKLEANWISMILCSKGGLYDLVKN
ELGSRHIMDEWLPQDESYIRAFPKGKSVHLLTGNVPLSGVLSILRAILTKNQCIIKTSST
DPFTANALALSFIDVDPHHPVTRSLSVVYWQHQGDISLAKEIMQHADVVVAWGGEDAINW
AVKHAPPDIDVMKFGPKKSFCIIDNPVDLVSAATGAAHDVCFYDQQACFSTQNIYYMGSH
YEEFKLALIEKLNLYAHILPNTKKDFDEKAAYSLVQKECLFAGLKVEVDVHQRWMVIESN
AGVELNQPLGRCVYLHHVDNIEQILPYVRKNKTQTISVFPWEAALKYRDLLALKGAERIV
EAGMNNIFRVGGAHDGMRPLQRLVTYISHERPSHYTAKDVAVEIEQTRFLEEDKFLVFVP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaatttcattcattattaacggtcgagttgaaatatttcctgaaagtgat
gatttagtgcaatccattaattttggtgataatagtgttcatttgccagtattgaatgat
tctcaagtaaaaaacattattgattataatgaaaataatgaattgcaattgcataacatt
atcaactttctctatacggtagggcaacgatggaaaaatgaagaatattcaagacgcagg
acatatattcgtgatctaaaaagatatatgggatattcagaagaaatggctaagctagag
gccaactggatatctatgattttgtgctctaaaggtggcctttatgatcttgtaaaaaat
gaacttggttctcgccatattatggatgaatggctacctcaggatgaaagttatattaga
gcttttccgaaaggaaaatccgtacatctgttgacgggtaatgtgccattatctggtgtg
ctgtctatattgcgtgcaattttaacaaagaatcaatgcattataaaaacctcatcaact
gatccttttaccgctaatgcattagcgctaagttttatcgatgtggaccctcatcatccg
gtaacgcgttctttgtcagtcgtatattggcaacatcaaggcgatatatcactcgcaaaa
gagattatgcaacatgcggatgtcgttgttgcttggggaggggaagatgcgattaattgg
gctgtaaagcatgcaccacccgatattgacgtgatgaagtttggtcctaaaaagagtttt
tgtattattgataaccctgttgatttagtatccgcagctacaggggcggctcatgatgtt
tgtttttacgatcagcaagcttgtttttccacccaaaatatatattacatgggaagtcat
tatgaagagtttaagctagcgttgatagaaaaattgaacttatatgcgcatatattacca
aacaccaaaaaagattttgatgaaaaggcggcctattccttagttcaaaaagaatgttta
tttgctggattaaaagtagaggttgatgttcatcagcgctggatggttattgagtcaaat
gcgggtgtagaactaaatcaaccacttggcagatgtgtgtatcttcatcacgtcgataat
attgagcaaatattgccttatgtgcgaaaaaataaaacgcaaaccatatctgtttttcct
tgggaggccgcgcttaagtatcgagacttattagcattaaaaggtgcagaaaggattgta
gaagcaggaatgaataatatatttcgggttggtggtgctcatgatggaatgagaccttta
caacgattggtgacatatatttcccatgaaagaccatcccactatactgctaaagatgtt
gcggtcgaaatagaacagactcgattcctggaagaagataagttcctggtatttgtccca
taa

DBGET integrated database retrieval system