KEGG   Photorhabdus asymbiotica: PAU_02899Help
Entry
PAU_02899         CDS       T00941                                 

Gene name
folE
Definition
(GenBank) FolE subunit of GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00790  Folate biosynthesis
pay01100  Metabolic pathways
Module
pay_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAU_02899 (folE)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PAU_02899 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAQ84987
UniProt: C7BR32
Position
complement(3352121..3352789)
Genome map
AA seq 222 aa AA seqDB search
MEKIMSSLSKEAELVHSALEARGLETPLRGQTLAPEVRKVRIEEHMTEIMKLLNLDLSDD
SLADTPGRIAKMYVDEIFSGLDYSNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI
DGKATVAYIPKDKVIGLSKINRIVQFFSQRPQVQERLTQQILIALQTLLGTNNVAVSIDA
VHYCVKARGIRDATSTTTTTSLGGLFKSSQNTRQEFLRTTRH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttggagaaaataatgtcatctctaagtaaagaagctgagcttgtgcattcagcgctggaa
gctcgtggccttgagactcctttacgtggtcagacactggcaccggaagtacgcaaagta
cgcattgaagagcatatgacggaaattatgaaactgttgaatcttgacctgagtgatgac
agtttggcggatacccccggtcgtattgcgaaaatgtatgttgacgaaattttttcaggg
ttggattacagcaatttcccgaaaatcaccttaatagaaaacaaaatgaaagtggatgaa
atggtgaccgtacgtgatatcacgttaaccagcacctgcgaacaccattttgtgactatt
gatggtaaagctactgttgcctatatcccaaaagataaagtcattgggttatctaagatt
aaccgtatcgtgcagtttttttcacagcgtccgcaggtacaagaacgcttgacacaacag
atcctgattgcattacagacgctgcttggtaccaataatgtcgcagtatctattgatgcg
gtccattattgtgtgaaggctcgaggcatccgtgatgcaaccagtaccacgacaacgaca
tctctgggagggttgtttaaatccagtcagaatacccgtcaggagtttttacgcacgact
cgccattag

DBGET integrated database retrieval system