KEGG   Photorhabdus asymbiotica: PAU_02950Help
Entry
PAU_02950         CDS       T00941                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00260  Glycine, serine and threonine metabolism
pay00680  Methane metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
pay01230  Biosynthesis of amino acids
Module
pay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pay_M00002  Glycolysis, core module involving three-carbon compounds
pay_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_02950 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PAU_02950 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAU_02950 (gpmA)
Enzymes [BR:pay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAU_02950 (gpmA)
Membrane trafficking [BR:pay04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PAU_02950 (gpmA)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAU_02950 (gpmA)
  Exosomal proteins of melanoma cells
   PAU_02950 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAQ85038
UniProt: C7BS08
Position
3410718..3411470
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWTDVALSEKGRAEAQQAGQLLKEAGFVFDFAYTSVL
KRAIHTLWNILDQVDQQWLPVEKSWKLNERHYGALQGLDKSETAAKYGDDQVKLWRRGFA
ITPPDLTKDDERFPGHDPRYSNLAPEELPVTESLATTIERVIPYWEDVIKPRVAKGEKVI
IAAHGNSLRALVKYLDNMSEETILELNIPTAVPLVYEFDENMKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaactggttctggtaagacatggcgaaagcgagtggaacaaagaaaac
cgttttactggctggactgacgttgctttatctgaaaaaggtcgtgccgaagctcaacaa
gcaggccaactgttgaaagaagcaggtttcgtttttgattttgcatacacctctgttctg
aaacgggctatccacactttatggaatattttggaccaagttgatcaacaatggttacct
gttgaaaaaagctggaagctaaatgaacgtcattatggtgccctgcaaggtctggacaaa
tcagaaactgccgctaaatatggcgatgatcaagttaaactgtggcgtcgtggttttgct
atcactcctccagatttaactaaagacgatgaacgctttccaggtcacgacccacgttac
tcaaatctggccccagaagaattacctgtgactgaaagcctggcgaccactatcgaacgg
gttattccttactgggaagacgtcattaaacctcgtgttgctaaaggtgagaaagtgatt
attgctgctcatggcaactctttgcgtgctctggttaaatatctggacaacatgagtgaa
gaaaccattcttgaactgaatatcccaacagccgtacctttggtttatgaattcgacgaa
aacatgaaacctatcaaacattactatctgggtaacgctgatgaaattgcagcgaaagca
gccgcggtagcaaaccagggcaaagcgaaataa

DBGET integrated database retrieval system